KEGG   Corallococcus coralloides: COCOR_05799Help
Entry
COCOR_05799       CDS       T01780                                 

Definition
hypothetical protein
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
ccx  Corallococcus coralloides
Brite
KEGG Orthology (KO) [BR:ccx00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    COCOR_05799
Enzymes [BR:ccx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     COCOR_05799
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(7300753..7303113)
Genome map
AA seq 786 aa AA seqDB search
MAPAYDALVIGTGFGGAVAACRLAQAGLSVRVLERGLRYPKGSFPRDFEDPRNGWLWQHR
QGLFDIKLLKGMSVVQAAGYGGGSLIYANVHLRPPPDVFASGWPEGYSRESLDPYYDLVA
HMLDVQPITASARGLPPKTKRMQEVAKKLGREAQFFYPNLAVRFAPAGEPMPNKFGVLQE
GCSYCGECDIGCNRRAKNTLDLNYLAVAEQRGAEVTTQAEVTRIEPLSPGYRVTFTDHAN
AGMQRTVDARRVFLCAGAVNSTELLLRNRDVLGTLPDLSARLGTRYSANGDFLAFAFDTK
EPWDPAVGPTITTGMVVDEGQGKDKTWFLFQEGGHPVQAAGLMMAMDPDRAMTLPADLLQ
RELVKVLRTRSKEMAAIENERGRFQAVFLAMGRDKSNGRLTLSPITRELQVQWDVPANLP
LYRTQEQLCEDVARALGTRAAYNPLWERLHLPVSVHNLGGCAMAEEPAYGVLTPDGEVHG
YPGLYVMDGAALPVGVGVNPSSSIAAVAERNVEQVIRQVKDAPTWVAPERVPTKAAPAYP
PRVSMRMMPEVETVASPVVPGTDPLGDVVVPPGGTVASPTPVVGLRFTERMKGFLQPNHP
SPEDFAGAARAGQRGGQTAEFVVTITLPNLDRFLAQESHGGIVQGTLHVRGFTPPGGAPV
ENGVFNLFVGTERFYERRMLYLMPFTGVDGQPYLLDGYKEVNDDAGFDVWSDTSTLYTVL
RKGHERTGPIVATGIIRLHLPDFLQQLTTFSVLGTSSPLKQADAMRRFGGMFMGTLWDVF
ARAKFD
NT seq 2361 nt NT seq  +upstreamnt  +downstreamnt
atggcaccggcatacgacgccctggtcatcggcaccgggtttggcggagcggtggcggcc
tgtcggctggcgcaggcgggtctgtccgtgcgcgtgctcgagcgcggcctgcgctacccg
aagggcagcttccctcgcgacttcgaggaccctcgcaacggctggctgtggcagcaccgc
caggggctcttcgacatcaagctcctcaaggggatgagcgtcgtgcaggccgcggggtac
ggcggcggctcgctcatctacgccaacgtgcacctgcgcccgccgccggacgtgttcgcg
tccgggtggccggagggctacagccgggagtcgttggatccgtactacgacctggtcgcg
cacatgctggacgtgcagcccatcaccgcctccgcgcgcgggctgccgcccaagacgaag
cggatgcaggaggtggcgaagaagctgggccgcgaggcgcagttcttctacccgaacctc
gccgtgcgcttcgcccccgcgggcgagcccatgcccaacaagttcggcgtgctccaggag
ggctgcagctactgcggcgagtgcgacatcggctgcaaccgccgcgcgaagaacaccctg
gacctgaactacctggccgtggccgaacagcggggcgcggaggtcaccacccaggcggag
gtcacccgcatcgagcccctgtcgccgggctaccgcgtcaccttcaccgaccacgccaac
gccggcatgcagcgcaccgtggacgcgcgccgcgtcttcctgtgcgcgggcgcggtgaac
tccacggagctcctgctgcgcaaccgcgacgtgctcggcacgctgccggacctgagcgcg
cggctgggcacgcgctattccgccaacggcgacttcctcgccttcgccttcgacacgaag
gagccgtgggaccccgcggtgggccccaccatcaccaccggcatggtggtggatgaaggc
cagggcaaggacaagacctggttcctcttccaggagggcgggcacccggtgcaggccgcg
gggctgatgatggccatggacccggaccgcgccatgacgctccctgcggacctgctccag
cgcgagctcgtgaaggtgctgcgcacgcgctccaaggagatggccgccatcgagaacgag
cgcggccgcttccaggccgtgttcctggccatgggccgggacaagtccaacggccgactg
acgctgtcccccatcacccgggagctccaggtgcagtgggacgtgcccgcgaacctgccg
ctgtaccgcacgcaggagcagctctgcgaggacgtggcccgcgcgctgggcacgcgcgcc
gcctacaacccgctctgggagcggctgcacctgccggtgtccgtgcacaacctgggcggc
tgcgccatggcggaggagcccgcgtacggcgtcctcacgcccgacggcgaggtgcacggc
tatcccggcctgtacgtcatggacggcgcggcgctcccggtgggcgtcggcgtcaacccc
tcctccagcatcgccgcggtggccgagcgcaacgtggagcaggtcatccgccaggtgaag
gacgcgccgacctgggtggcgccggagcgcgtgcccacgaaggccgcgcccgcgtatccg
ccccgcgtcagcatgcggatgatgccggaggtggagacggtggcctcgccggtggtgccg
ggaacggatccgctgggcgacgtggtggttccgcccggcggaacggtggcgtcccccacg
ccggtggtgggcctgcgcttcacggagcggatgaagggcttcctccagccgaaccacccg
tcgccggaggacttcgccggagcggcgcgagcgggccagcgcggggggcagacggcggag
ttcgtcgtcaccatcacgctgcccaacctggaccgcttcctcgcgcaggagtcacacggc
ggcatcgtgcagggcacgctgcacgtgcgcggcttcacgccgcccgggggcgcgccggtg
gagaacggcgtcttcaacctcttcgtgggcacggagcgcttctacgagcggcgcatgctg
tacctgatgcccttcaccggcgtggacggccagccgtacctcctggatggctacaaggag
gtcaacgacgacgcggggttcgacgtgtggagcgacacgtccacgctctacaccgtgctg
cgcaaggggcatgagcgcaccggccccatcgtcgccaccggcatcatccgcctgcacctg
ccggacttcctccagcagctcaccacgttctccgtgctgggcacgtcctcgccgctgaag
caggcggatgcgatgcggcgcttcggcggcatgttcatgggcacgctctgggacgtcttc
gcccgcgcgaagttcgattag

DBGET integrated database retrieval system