KEGG   Corallococcus coralloides: COCOR_06057Help
Entry
COCOR_06057       CDS       T01780                                 

Gene name
caiD1
Definition
(RefSeq) enoyl-CoA hydratase
  KO
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
ccx  Corallococcus coralloides
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ccx00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    COCOR_06057 (caiD1)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    COCOR_06057 (caiD1)
   00650 Butanoate metabolism
    COCOR_06057 (caiD1)
  Lipid metabolism
   00071 Fatty acid degradation
    COCOR_06057 (caiD1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    COCOR_06057 (caiD1)
   00310 Lysine degradation
    COCOR_06057 (caiD1)
   00360 Phenylalanine metabolism
    COCOR_06057 (caiD1)
   00380 Tryptophan metabolism
    COCOR_06057 (caiD1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    COCOR_06057 (caiD1)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    COCOR_06057 (caiD1)
   00281 Geraniol degradation
    COCOR_06057 (caiD1)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    COCOR_06057 (caiD1)
   00627 Aminobenzoate degradation
    COCOR_06057 (caiD1)
   00930 Caprolactam degradation
    COCOR_06057 (caiD1)
Enzymes [BR:ccx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     COCOR_06057 (caiD1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(7638682..7639443)
Genome map
AA seq 253 aa AA seqDB search
MSVRVEKNGPVTTVILHRPEVRNAVDAGTAQELADAFRAFDADPDAKVGVLYGDAGTFCA
GADLKAVSEGRLLRLEPDGDGPMGPSRMRLSKPVVAAISGHAVAGGLELALWCDLRVAEE
DAVLGVFCRRWGVPLIDGGTVRLPRLIGLSRALDLILTGRPVPASEALGMGLVNRVVPKG
EARAAAEALAAQVAFFPQACMNADRASAYAQGDLAFEDAMRQEFEGGVKVLQSESIPGAT
RFAKGAGRHGQFE
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtgcgcgtcgagaagaacggccccgtcaccaccgtcatcctccaccggccggag
gtccgcaacgcggtggacgctggcacggcccaggaactggcggacgccttccgggccttc
gacgcggaccccgacgcgaaggtgggcgtcctgtacggcgatgcgggcaccttctgcgcg
ggcgcggacctcaaggccgtgtcggaagggcgcctcttgcgcctggagccggacggggac
gggcccatgggaccttcgcgcatgcgcctgtccaagcccgtggtggcggccatcagcggc
cacgcggtggcgggcggcctggagttggcgctgtggtgcgacctgcgcgtggcggaggag
gacgcggtgctgggcgtcttctgccgccgctggggcgtgcccctcatcgacggaggcacc
gtgcgcctgccccggctgattggcctgtcgcgcgcgctggacctcatcctcaccggccgc
cccgtgcctgcctccgaggcgctgggcatgggcctggtcaaccgcgtggtaccgaagggg
gaggcccgggccgcggcggaggcgctggccgcccaggtcgccttcttcccccaggcctgc
atgaacgcggaccgggcttccgcctatgcccagggcgacctggccttcgaagacgcgatg
cgccaggagttcgagggcggggtgaaggtgctccagtcggagtccatccccggggccacg
cgcttcgcgaagggggcgggccggcacggccagttcgagtag

DBGET integrated database retrieval system