KEGG   Corallococcus coralloides: COCOR_06057Help
Entry
COCOR_06057       CDS       T01780                                 

Gene name
caiD1
Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
ccx  Corallococcus coralloides
Pathway
ccx00071  Fatty acid degradation
ccx00280  Valine, leucine and isoleucine degradation
ccx00281  Geraniol degradation
ccx00310  Lysine degradation
ccx00360  Phenylalanine metabolism
ccx00362  Benzoate degradation
ccx00380  Tryptophan metabolism
ccx00410  beta-Alanine metabolism
ccx00627  Aminobenzoate degradation
ccx00640  Propanoate metabolism
ccx00650  Butanoate metabolism
ccx00903  Limonene and pinene degradation
ccx00930  Caprolactam degradation
ccx01100  Metabolic pathways
ccx01110  Biosynthesis of secondary metabolites
ccx01120  Microbial metabolism in diverse environments
ccx01130  Biosynthesis of antibiotics
ccx01212  Fatty acid metabolism
Module
ccx_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ccx00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    COCOR_06057 (caiD1)
   00650 Butanoate metabolism
    COCOR_06057 (caiD1)
  Lipid metabolism
   00071 Fatty acid degradation
    COCOR_06057 (caiD1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    COCOR_06057 (caiD1)
   00310 Lysine degradation
    COCOR_06057 (caiD1)
   00360 Phenylalanine metabolism
    COCOR_06057 (caiD1)
   00380 Tryptophan metabolism
    COCOR_06057 (caiD1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    COCOR_06057 (caiD1)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    COCOR_06057 (caiD1)
   00281 Geraniol degradation
    COCOR_06057 (caiD1)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    COCOR_06057 (caiD1)
   00627 Aminobenzoate degradation
    COCOR_06057 (caiD1)
   00930 Caprolactam degradation
    COCOR_06057 (caiD1)
Enzymes [BR:ccx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     COCOR_06057 (caiD1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AFE08250
UniProt: H8ML24
Position
complement(7638682..7639443)
Genome map
AA seq 253 aa AA seqDB search
MSVRVEKNGPVTTVILHRPEVRNAVDAGTAQELADAFRAFDADPDAKVGVLYGDAGTFCA
GADLKAVSEGRLLRLEPDGDGPMGPSRMRLSKPVVAAISGHAVAGGLELALWCDLRVAEE
DAVLGVFCRRWGVPLIDGGTVRLPRLIGLSRALDLILTGRPVPASEALGMGLVNRVVPKG
EARAAAEALAAQVAFFPQACMNADRASAYAQGDLAFEDAMRQEFEGGVKVLQSESIPGAT
RFAKGAGRHGQFE
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtgcgcgtcgagaagaacggccccgtcaccaccgtcatcctccaccggccggag
gtccgcaacgcggtggacgctggcacggcccaggaactggcggacgccttccgggccttc
gacgcggaccccgacgcgaaggtgggcgtcctgtacggcgatgcgggcaccttctgcgcg
ggcgcggacctcaaggccgtgtcggaagggcgcctcttgcgcctggagccggacggggac
gggcccatgggaccttcgcgcatgcgcctgtccaagcccgtggtggcggccatcagcggc
cacgcggtggcgggcggcctggagttggcgctgtggtgcgacctgcgcgtggcggaggag
gacgcggtgctgggcgtcttctgccgccgctggggcgtgcccctcatcgacggaggcacc
gtgcgcctgccccggctgattggcctgtcgcgcgcgctggacctcatcctcaccggccgc
cccgtgcctgcctccgaggcgctgggcatgggcctggtcaaccgcgtggtaccgaagggg
gaggcccgggccgcggcggaggcgctggccgcccaggtcgccttcttcccccaggcctgc
atgaacgcggaccgggcttccgcctatgcccagggcgacctggccttcgaagacgcgatg
cgccaggagttcgagggcggggtgaaggtgctccagtcggagtccatccccggggccacg
cgcttcgcgaagggggcgggccggcacggccagttcgagtag

DBGET integrated database retrieval system