KEGG   Corallococcus coralloides: COCOR_06570Help
Entry
COCOR_06570       CDS       T01780                                 

Gene name
sucB
Definition
2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ccx  Corallococcus coralloides
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ccx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    COCOR_06570 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    COCOR_06570 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    COCOR_06570 (sucB)
Enzymes [BR:ccx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     COCOR_06570 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8262587..8263792
Genome map
AA seq 401 aa AA seqDB search
MAVELKVPPLGESITEAVVGKWNKKQGESVSADEPLVVLETDKVTIDVPAPAAGSVASIA
FKEGDKVRVGDVLGTIEAGAGAAASPAVAAATPAPAQAAAPVAAPAQAASDTRITPTARK
MAEENRVDVGQLKGSGTGGRIMKEDVQGQLNRPSAPPAPAAPSGPRPNAAREERVRMTPL
RKRVAERLIQAQSTAAMLTTFNEVDMGEVMALRKKYNDKFQAKHGVKLGFMSFFIRASVE
ALKAFPQINAEIDGEDVIFKHYYDIGVAVSGSRGLVVPVVRDADKLSLADLEKTVGDYGG
RARNDKLTMADLTGGTFTITNGGIFGSMLSTPILNPPQTGILGMHNIVERPVARDGQVVI
RPIMYIALTYDHRLVDGREAVQFLVRVKECIEDPERLLLDI
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atggccgttgaactgaaagtccccccgctcggcgaatccatcaccgaggccgtcgtcggc
aagtggaacaagaagcagggtgagtctgtctccgcggacgagccgctcgtcgtgctggag
accgacaaggtcaccatcgacgtgccggcgcccgccgcgggcagcgtcgcgtccatcgcc
ttcaaggagggcgacaaggtccgcgtgggcgacgtgctgggcaccatcgaggccggtgcc
ggcgccgccgcctctcccgccgtggccgccgccacgcccgcgcccgcccaggccgcggcg
cccgtggcggctccggctcaggccgccagcgacacgcgcatcacccccaccgccaggaag
atggcggaggagaaccgggtggacgtgggccagctgaagggctccggcaccggtggccgc
atcatgaaggaggacgtgcagggtcagctgaaccgcccgtccgcgcctccggccccggcc
gctccgtccggtccccgccccaacgccgcgcgcgaggagcgcgtgcgcatgacgccgctg
cgcaagcgcgtggccgagcgcctcatccaggcgcagtccaccgccgccatgctcaccacc
ttcaacgaggtggacatgggcgaggtgatggcgctccgcaagaagtacaacgacaagttc
caggcgaagcacggggtgaagctcgggttcatgagcttcttcatccgcgcgtccgtggag
gccctcaaggcgttcccgcagatcaacgcggagatcgacggcgaggacgtcatcttcaag
cactactacgacatcggcgtggccgtgagcggcagccgtggcctggtggtgccggtggtg
cgtgacgcggacaagctgtcgctcgcggacctggagaagacggtcggtgactacggcggc
cgtgcgcgcaacgacaagctgacgatggccgacctcacgggcggcacgttcaccatcacc
aacggcggcatcttcggctccatgctgtccacgcccatcctgaacccgccgcagacgggc
atcctgggcatgcacaacatcgtggagcgccccgtggcccgcgacggccaggtggtcatc
cggcccatcatgtacatcgccctcacgtacgaccaccgcctggtggacggccgcgaggcg
gtgcagttcctggtgcgcgtgaaggagtgcatcgaggaccccgagcgcctgctgctcgac
atctga

DBGET integrated database retrieval system