KEGG   Corallococcus coralloides: COCOR_06570Help
Entry
COCOR_06570       CDS       T01780                                 

Gene name
sucB
Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ccx  Corallococcus coralloides
Pathway
ccx00020  Citrate cycle (TCA cycle)
ccx00310  Lysine degradation
ccx01100  Metabolic pathways
ccx01110  Biosynthesis of secondary metabolites
ccx01120  Microbial metabolism in diverse environments
ccx01130  Biosynthesis of antibiotics
ccx01200  Carbon metabolism
Module
ccx_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ccx_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ccx00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    COCOR_06570 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    COCOR_06570 (sucB)
Enzymes [BR:ccx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     COCOR_06570 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H
Motif
Other DBs
NCBI-ProteinID: AFE10432
UniProt: H8MUP5
Position
8262587..8263792
Genome map
AA seq 401 aa AA seqDB search
MAVELKVPPLGESITEAVVGKWNKKQGESVSADEPLVVLETDKVTIDVPAPAAGSVASIA
FKEGDKVRVGDVLGTIEAGAGAAASPAVAAATPAPAQAAAPVAAPAQAASDTRITPTARK
MAEENRVDVGQLKGSGTGGRIMKEDVQGQLNRPSAPPAPAAPSGPRPNAAREERVRMTPL
RKRVAERLIQAQSTAAMLTTFNEVDMGEVMALRKKYNDKFQAKHGVKLGFMSFFIRASVE
ALKAFPQINAEIDGEDVIFKHYYDIGVAVSGSRGLVVPVVRDADKLSLADLEKTVGDYGG
RARNDKLTMADLTGGTFTITNGGIFGSMLSTPILNPPQTGILGMHNIVERPVARDGQVVI
RPIMYIALTYDHRLVDGREAVQFLVRVKECIEDPERLLLDI
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atggccgttgaactgaaagtccccccgctcggcgaatccatcaccgaggccgtcgtcggc
aagtggaacaagaagcagggtgagtctgtctccgcggacgagccgctcgtcgtgctggag
accgacaaggtcaccatcgacgtgccggcgcccgccgcgggcagcgtcgcgtccatcgcc
ttcaaggagggcgacaaggtccgcgtgggcgacgtgctgggcaccatcgaggccggtgcc
ggcgccgccgcctctcccgccgtggccgccgccacgcccgcgcccgcccaggccgcggcg
cccgtggcggctccggctcaggccgccagcgacacgcgcatcacccccaccgccaggaag
atggcggaggagaaccgggtggacgtgggccagctgaagggctccggcaccggtggccgc
atcatgaaggaggacgtgcagggtcagctgaaccgcccgtccgcgcctccggccccggcc
gctccgtccggtccccgccccaacgccgcgcgcgaggagcgcgtgcgcatgacgccgctg
cgcaagcgcgtggccgagcgcctcatccaggcgcagtccaccgccgccatgctcaccacc
ttcaacgaggtggacatgggcgaggtgatggcgctccgcaagaagtacaacgacaagttc
caggcgaagcacggggtgaagctcgggttcatgagcttcttcatccgcgcgtccgtggag
gccctcaaggcgttcccgcagatcaacgcggagatcgacggcgaggacgtcatcttcaag
cactactacgacatcggcgtggccgtgagcggcagccgtggcctggtggtgccggtggtg
cgtgacgcggacaagctgtcgctcgcggacctggagaagacggtcggtgactacggcggc
cgtgcgcgcaacgacaagctgacgatggccgacctcacgggcggcacgttcaccatcacc
aacggcggcatcttcggctccatgctgtccacgcccatcctgaacccgccgcagacgggc
atcctgggcatgcacaacatcgtggagcgccccgtggcccgcgacggccaggtggtcatc
cggcccatcatgtacatcgccctcacgtacgaccaccgcctggtggacggccgcgaggcg
gtgcagttcctggtgcgcgtgaaggagtgcatcgaggaccccgagcgcctgctgctcgac
atctga

DBGET integrated database retrieval system