KEGG   Corallococcus coralloides: COCOR_06592Help
Entry
COCOR_06592       CDS       T01780                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
ccx  Corallococcus coralloides
Pathway
ccx00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ccx01100  Metabolic pathways
ccx01110  Biosynthesis of secondary metabolites
ccx01130  Biosynthesis of antibiotics
ccx01230  Biosynthesis of amino acids
Module
ccx_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ccx00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    COCOR_06592 (trpC)
Enzymes [BR:ccx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     COCOR_06592 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS NanE His_biosynth QRPTase_C IMPDH
Motif
Other DBs
NCBI-ProteinID: AFE10545
UniProt: H8MW47
Position
8293048..8293866
Genome map
AA seq 272 aa AA seqDB search
MTTTSSAAKPVESPGTLDVIMARKRRELGTRPPPTHGAHPPTRDFAQALVRRVPGHPVNV
IAEVKRKSPSGGAFPHADVVAVARSYEAAGACAISVLTDGPDFGGSLEDLVAVRAAVSIP
VLRKDFLVAASEVEESAAWGADAVLLIADALGDTELREMIAAAKQVRVAALVEAHTEAHA
ERALAAGASIIGLNNRNLATLKTDTGTALRVMPTLRSRSTALVAESGLKHLADLTAARDA
GANAVLVGESLLRDADPGRALRRLLGLEGGGT
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccacctcttcggccgcgaagcccgtggaatcaccgggcacactggacgtcatc
atggcgcgcaagcgccgggagctgggcacccgccctcctcccacgcatggcgcgcatccc
ccgacgcgggacttcgcccaggcgctggtgcgccgcgtgcccggacatccggtcaacgtc
atcgcggaggtgaagcgcaagagcccctcgggcggcgccttcccgcatgcggacgtggtc
gcggtggcccgctcctatgaagccgccggcgcctgcgccatcagcgtgctcacggacggg
ccggacttcggcggcagcctggaggacctggtcgcggtccgcgccgccgtctccatcccc
gtgctgcgcaaggacttcctcgtcgccgccagcgaggtggaggagagcgcggcctggggc
gcggacgcggtgctgctcatcgcggacgcgctcggagacacggagctccgggagatgatc
gccgccgcgaagcaggtgcgcgtggccgcgctcgtggaggcccacacggaggcgcacgcc
gaacgcgcgctcgccgcgggcgcgagcatcatcggcctcaacaaccgcaacctcgccacg
ctgaagacggacaccggcacggcgctccgggtgatgcccacgctgcgctcccggtccacc
gccctggtcgcggagagcggcctcaagcacctggcggacctcaccgccgcgcgcgacgcg
ggcgccaacgccgtgctcgtgggcgagtccctcctgcgcgacgcggaccccggccgggcc
ctgcgccggctgctcggcctggaaggcggcgggacatga

DBGET integrated database retrieval system