KEGG   Corallococcus coralloides: COCOR_06594Help
Entry
COCOR_06594       CDS       T01780                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase subunit beta
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ccx  Corallococcus coralloides
Pathway
ccx00260  Glycine, serine and threonine metabolism
ccx00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ccx01100  Metabolic pathways
ccx01110  Biosynthesis of secondary metabolites
ccx01130  Biosynthesis of antibiotics
ccx01230  Biosynthesis of amino acids
Module
ccx_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ccx00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    COCOR_06594 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    COCOR_06594 (trpB)
Enzymes [BR:ccx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     COCOR_06594 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Acetyltransf_6
Motif
Other DBs
NCBI-ProteinID: AFE10544
UniProt: H8MW49
Position
8294507..8295712
Genome map
AA seq 401 aa AA seqDB search
MTTDTAVGRFGRYGGRYVPETLVPALLELEEAYAKAQQDASFGEEVTRVLREYVGRPTTL
TPAHRLTEAWGGAQVWLKREDLAHTGAHKINNTVGQVLLARRMGKKRIIAETGAGQHGVA
TATACALFGLPCEVFMGALDVERQALNVFRMRALGAVVRPVESGSRTLKDAMNEAMRVWV
SQVQDTYYVIGSAAGPHPYPTIVRDFQSVIGREIRAQTLATMGRLPDAIIACVGGGSNAI
GALHPFIPDTAVRLVGVEAAGHGLDSGQHGASLTLGTEGVLHGSRSLVLQDEHGQIQEAH
SISAGLDYPGVGPELAHLAKTGRMEVRTATDDDALTAFYEVARTEGILPALETSHAFAAA
RSLARDMGKGKHLVINCSGRGDKDVATISARGVPPATGVKS
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgacgacggacactgccgtgggccgcttcggccgttacggcggacgctatgtgccggag
accctggtcccggcgctgctggagctggaagaggcctacgcgaaggcgcagcaggacgcg
tccttcggcgaggaggtcacccgcgtgctgcgcgaatacgtgggccgtcccaccacgctg
acgcccgcgcaccgcctcacggaggcgtggggtggcgcgcaggtgtggctcaagcgcgag
gacctggcgcacacgggcgcgcacaaaatcaacaacaccgtgggccaggtgctgctcgcc
cggcgcatgggcaagaagcgcatcatcgcggagacgggcgcgggccagcacggcgtggcc
accgccaccgcgtgcgcgctcttcggcctgccctgcgaagtcttcatgggcgcgctggac
gtggagcgccaggcgctcaacgtcttccgcatgcgcgcgctgggcgcggtggtgcggccg
gtggagtcgggctcgcgcacgctcaaggacgcgatgaacgaagccatgcgcgtctgggtg
tcgcaggtgcaggacacctactacgtcatcggcagcgcggcgggcccgcacccctacccc
accatcgtgcgcgacttccaatccgtcatcggccgggagattcgcgcccagacgctggcc
acgatgggccggctgccggacgccatcatcgcgtgcgtgggcggcggctcgaacgccatc
ggcgcgctgcaccccttcatcccggacacggcggtgcggctcgtcggcgtggaggccgcg
ggccacggcctggactccggccagcacggcgcgtcgctgacgctgggcacggagggcgtg
ctgcacggctcgcgctcgctggtgctccaggacgagcacggccagattcaagaggcgcac
agcatctccgccggcctggactacccgggcgtgggaccggagctggcgcacctggcgaag
acgggacgcatggaggtgcgcaccgcgacggacgacgacgcgctcaccgccttctacgag
gtcgcgcgcacggagggcatcctccccgcgctggagacgtcgcacgcgttcgcggcggcg
cgctcgctggcccgcgatatgggcaagggcaagcacctggtcatcaactgctcgggccgg
ggtgacaaggacgtcgcgaccatctcggcgcgcggcgtgccaccggccacgggggtgaag
tcatga

DBGET integrated database retrieval system