KEGG   Corallococcus coralloides: COCOR_06595Help
Entry
COCOR_06595       CDS       T01780                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase subunit alpha
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ccx  Corallococcus coralloides
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ccx00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    COCOR_06595 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    COCOR_06595 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    COCOR_06595 (trpA)
Enzymes [BR:ccx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     COCOR_06595 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
8295709..8296500
Genome map
AA seq 263 aa AA seqDB search
MSTELGKAFAKAKARGEGALVAYAMAGDPDLPKSVDVFAAMVEGGADVLEIGVAFSDPIA
DGPVIQAASERALKAGATLRRVLDEVVPEVRRRCPETPLVIMTYVNVVMAMGEERYAKLA
RERGISGTILPDLPPEESAGIRAAFDKEGVDLVPLCAPTTPPARAEAIAKDARGFVYCVS
VAGVTGMRAELPPDLSQRLDLVKRAASVPVVAGFGISNADTARPLVAHADGVVVGSALVK
AAHSDGPAAAKQLCADIKRGLKR
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgagcacggagctgggcaaggcgttcgcgaaggcgaaggcccggggagaaggcgcgctg
gtggcgtacgcgatggcgggcgacccggacctgccgaagtccgtggacgtcttcgccgcg
atggtggagggcggcgcggacgtgctggagattggcgtggcgttcagcgaccccatcgcg
gacggccctgtcatccaggccgcgtcggagcgggcgctgaaggccggagccaccctgcgc
cgcgtgctggatgaagtggtgccggaggtgcgccgccgctgcccggagacgccgctggtc
atcatgacctacgtcaacgtggtgatggccatgggcgaggagcgctacgcgaagctcgcg
cgagagcggggcatctccggcaccatcctcccggacctgccgccggaagagagcgcgggc
atccgcgccgcgttcgacaaggagggcgtggacctggtgcccctgtgcgcgcccaccacg
ccgcccgcgcgcgcggaggccatcgcgaaggacgcgcgaggcttcgtctattgcgtgtcc
gtggcgggcgtcaccggcatgcgcgcggagctgccgccggacctgtcgcagcggctggac
ctggtgaagcgcgccgcgtccgtaccggtggtggcgggcttcggcatctccaacgcggac
acggcccggccgttggtggcccacgcggacggcgtcgtggtgggcagcgcgctggtgaag
gccgcccactcggacggccctgccgccgcgaagcaactctgcgcggacatcaagcgcggc
ctgaagcgctaa

DBGET integrated database retrieval system