KEGG   Corallococcus coralloides: COCOR_06595Help
Entry
COCOR_06595       CDS       T01780                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase subunit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ccx  Corallococcus coralloides
Pathway
ccx00260  Glycine, serine and threonine metabolism
ccx00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ccx01100  Metabolic pathways
ccx01110  Biosynthesis of secondary metabolites
ccx01130  Biosynthesis of antibiotics
ccx01230  Biosynthesis of amino acids
Module
ccx_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ccx00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    COCOR_06595 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    COCOR_06595 (trpA)
Enzymes [BR:ccx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     COCOR_06595 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA BtpA NMO PcrB His_biosynth Adeno_VII Pterin_bind DUF561
Motif
Other DBs
NCBI-ProteinID: AFE10543
UniProt: H8MW50
Position
8295709..8296500
Genome map
AA seq 263 aa AA seqDB search
MSTELGKAFAKAKARGEGALVAYAMAGDPDLPKSVDVFAAMVEGGADVLEIGVAFSDPIA
DGPVIQAASERALKAGATLRRVLDEVVPEVRRRCPETPLVIMTYVNVVMAMGEERYAKLA
RERGISGTILPDLPPEESAGIRAAFDKEGVDLVPLCAPTTPPARAEAIAKDARGFVYCVS
VAGVTGMRAELPPDLSQRLDLVKRAASVPVVAGFGISNADTARPLVAHADGVVVGSALVK
AAHSDGPAAAKQLCADIKRGLKR
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgagcacggagctgggcaaggcgttcgcgaaggcgaaggcccggggagaaggcgcgctg
gtggcgtacgcgatggcgggcgacccggacctgccgaagtccgtggacgtcttcgccgcg
atggtggagggcggcgcggacgtgctggagattggcgtggcgttcagcgaccccatcgcg
gacggccctgtcatccaggccgcgtcggagcgggcgctgaaggccggagccaccctgcgc
cgcgtgctggatgaagtggtgccggaggtgcgccgccgctgcccggagacgccgctggtc
atcatgacctacgtcaacgtggtgatggccatgggcgaggagcgctacgcgaagctcgcg
cgagagcggggcatctccggcaccatcctcccggacctgccgccggaagagagcgcgggc
atccgcgccgcgttcgacaaggagggcgtggacctggtgcccctgtgcgcgcccaccacg
ccgcccgcgcgcgcggaggccatcgcgaaggacgcgcgaggcttcgtctattgcgtgtcc
gtggcgggcgtcaccggcatgcgcgcggagctgccgccggacctgtcgcagcggctggac
ctggtgaagcgcgccgcgtccgtaccggtggtggcgggcttcggcatctccaacgcggac
acggcccggccgttggtggcccacgcggacggcgtcgtggtgggcagcgcgctggtgaag
gccgcccactcggacggccctgccgccgcgaagcaactctgcgcggacatcaagcgcggc
ctgaagcgctaa

DBGET integrated database retrieval system