KEGG   Corallococcus coralloides: COCOR_06826Help
Entry
COCOR_06826       CDS       T01780                                 

Gene name
ycjM
Definition
putative sucrose phosphorylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
ccx  Corallococcus coralloides
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:ccx00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    COCOR_06826 (ycjM)
Enzymes [BR:ccx01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     COCOR_06826 (ycjM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8573284..8574960
Genome map
AA seq 558 aa AA seqDB search
MSASGHTAHPVRAPARARLGDALGQLYGAERAEALVRELAQAAEGVRARPRPGHARPAVI
AVYPDHVLDGGMAPLAALRRFLDEEVGGVGPALLHVLPPYVSDGDDGFAVVDHRAVHPRL
GTWEDLERLSEVSGGLMLDLVMNHVSTSHPAFRDVLRGEGRPGDFHLFSEPRDIEWGTRV
RTSSILQRFGAVWAWCTYGRAQVDLNHGSPDVFLSMAGTLLRLVEAGARVVRLDAIPHVW
KRVPGGPHQPEAKLLVRALRAVADLVDPSVRLLAETDHRTGERCYLGEELAQHDNHLAVP
LLVFTAALAGEGGPLVDWVNASAAEAHGRDGYAFLQTHDGVHLRPMDPPLDAPTLRRVMA
RLERAGVRVSYADVGGEPRPYELNSSLHRIFSTEAGLDVERYLAAHALLFALPATPCLYF
PTLFGLPDAVGVEPSNPRAANRHRYSDGALRALVRQSVHARILKSLLGLIRLRDQTPALR
EDSGCEARLPAPQVLHLARGHGRQPLHVLVNFGVEPVSVPVPLRRWADLLGGRQGQGDVL
LAPSEALWLVEAGSGDLT
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcctccggacacacggcccacccggtccgcgcccccgcgagggcgcggctgggg
gatgcgctgggacagctctacggggcggagcgcgcggaggcgctcgtccgggagctggcc
caggcggcggagggcgtccgcgcgcgcccgaggcccgggcacgcgcggcccgcggtcatc
gccgtgtatccggaccacgtgctcgacgggggcatggctccgctcgcggcgctgcggcgc
ttcctcgacgaggaggtaggcggcgtgggaccagccctgctgcacgtgctcccgccctat
gtgtcggacggggatgacggcttcgcggtggtggaccaccgggccgtgcatccgcgcctg
gggacgtgggaggacctggagcggctgtcggaggtgagcggcgggctgatgctcgacctg
gtgatgaaccacgtgtccacgtcgcacccggcattccgggacgtgctgcgcggggaggga
cggcccggggacttccacctcttctccgagccgcgcgacatcgagtgggggacgcgggtg
cggacctcctccatcctccagcgctttggcgccgtctgggcgtggtgcacgtacgggcgc
gcccaggtggacctgaaccacggctcgccagacgtcttcctgtccatggcggggaccctg
ctgcggctggtggaggcgggcgcgcgggtcgtgcgtctggatgccattccccacgtgtgg
aagcgcgttcccggagggccgcaccagccggaggcgaagctgctggtgcgcgcgctgcgt
gccgtggccgacctggtggacccgtcggtgcgcctgctcgctgagacggaccaccgcacg
ggagagcggtgctacctgggcgaggagttggcgcagcacgacaaccacctcgcggtgccg
ctgctcgtcttcacggcggcgctcgcgggcgagggcggcccgttggtggactgggtgaac
gcgtccgcagcggaggcccacggccgcgacggctacgccttcctccagacgcatgacggc
gtgcacctgcgtcccatggatccgccgctggacgcccccaccctgcggcgggtgatggcg
cggctggagcgcgccggggtccgggtgtcctacgcggacgtggggggagaaccccggccg
tacgagctcaacagctccctgcatcgcatcttctccacggaggcggggctcgacgtcgag
cgctacctggccgcgcacgcgctgctcttcgcgctccccgccacgccctgtctctacttc
cccacgctgttcggactgccggacgcggtgggcgtcgagccctccaatccccgcgccgcg
aaccggcaccggtactcggatggggccctgcgtgcgctggtccggcagtcggtgcacgcg
cgcatcctgaagtccctgctgggcctcatccgcctgcgcgaccaaacgcccgcgctgcgg
gaggacagtggctgcgaggcgcggctgccagcgccccaggtcctgcacctggcgcgaggc
catggccgtcagccgctgcacgtgttggtgaacttcggcgtggaacccgtgtccgtcccc
gtgccgttgcggaggtgggcggacctgctcggcgggcgtcagggccagggggacgtcctg
ctcgcgccttccgaggcgctgtggctcgtggaagccgggagtggagacctcacatga

DBGET integrated database retrieval system