KEGG   Corallococcus coralloides: COCOR_06991Help
Entry
COCOR_06991       CDS       T01780                                 

Gene name
pfkA
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ccx  Corallococcus coralloides
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ccx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    COCOR_06991 (pfkA)
   01230 Biosynthesis of amino acids
    COCOR_06991 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    COCOR_06991 (pfkA)
   00030 Pentose phosphate pathway
    COCOR_06991 (pfkA)
   00051 Fructose and mannose metabolism
    COCOR_06991 (pfkA)
   00052 Galactose metabolism
    COCOR_06991 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    COCOR_06991 (pfkA)
Enzymes [BR:ccx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     COCOR_06991 (pfkA)
Protein phosphatases and associated proteins [BR:ccx01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     COCOR_06991 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8782001..8783038
Genome map
AA seq 345 aa AA seqDB search
MKVAVLTGGGDCPGLNAVIRAIVRRASEHGFEMMGLRDGWKGLLDDNHFRLTRETTSGIL
HRGGTILGTSRVNPFKVENGLERVKRAIERNGIHAVIAIGGEGTLSAATRMSQEGLRIVG
VPKTIDNDLNGTDFTFGFDTAVHIATEAVDRLHSTAESHKRVIVCEVMGRHVGWIATYAG
IAGGADVILVPEIPADLEAVAQHLQRRHAGGRSFSIVVVAEGTRIKMSADQNEQLVTTGA
LDEAGRPRLGGVGNIVASEIERRTGFETRVSVLGHIQRGGAPTAHDRVLATRFGVHACDM
VARGEFGKMAALRGNEIVSEQLAEATRELKRVPKEFFEVAQVFFG
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtcgccgtgctcaccggcgggggtgattgccccggcctcaatgcggtcatccgc
gccattgtccgccgtgccagcgagcacggcttcgagatgatgggcctgcgtgatggatgg
aagggcctgctggacgacaaccacttccgcctcacgcgggagaccacctccggcatcctc
caccggggtggcaccatcctgggcacctcgcgcgtcaacccgttcaaggtggagaacggc
ctggagcgcgtgaagcgcgccatcgaacgcaatggcatccacgcggtcatcgccattggc
ggcgagggcaccctgtccgccgccacgcgcatgtcccaggagggcctgcgcatcgtcggc
gtgccgaagaccatcgacaacgacctcaacggcacggacttcacgttcgggttcgacacc
gcggtccacatcgcgacggaggccgtggaccggctgcactccaccgcggagtcgcacaag
cgcgtcatcgtctgcgaggtgatgggccgtcacgtcggctggatcgccacctacgcgggc
atcgccggcggcgcggacgtcatcctcgtcccggagattcccgcggacctggaggccgtc
gcgcagcacctccagcgccggcacgcgggcgggcgctccttctccatcgtggtggtggcg
gaaggcacgcgcatcaagatgtccgcggaccagaacgagcagctcgtcaccacgggcgcc
ctggacgaagcgggccgtccgcgcctgggcggcgtgggcaacatcgtcgcgtcggagatt
gagcggcgcaccggcttcgagacgcgcgtctccgtgctgggccacatccagcgcggcggc
gcccccacggcgcacgaccgcgtgctcgccacccggttcggcgtgcatgcgtgcgacatg
gtggcccggggcgagttcggcaagatggccgccctgcgcggcaacgaaatcgtcagcgag
cagctggccgaagccacccgcgagctcaagcgcgtgcccaaggagttcttcgaggtcgcg
caggttttcttcggctga

DBGET integrated database retrieval system