KEGG   Corallococcus coralloides: COCOR_06999Help
Entry
COCOR_06999       CDS       T01780                                 

Gene name
fucA
Definition
(GenBank) L-fuculose phosphate aldolase
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
ccx  Corallococcus coralloides
Pathway
ccx00051  Fructose and mannose metabolism
ccx01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ccx00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    COCOR_06999 (fucA)
Enzymes [BR:ccx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     COCOR_06999 (fucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: AFE08853
UniProt: H8MFR9
Position
complement(8792426..8793070)
Genome map
AA seq 214 aa AA seqDB search
MSGAGGHQDLREAMVATSRRMNTSGLNQGTSGNLSQRVEGGFLLTPSGMNYETMTPEDLV
LMRFDGSHEGHRKPSTEWQLHRDILQARPEVGAVLHTHSMFSTTLACLRRGIPAFHYMVS
AAGGTDIRCAEYATFGTPELARHMMVALEGRKACLLANHGMVAMGGDLAAAWKLAVEVET
LAAMYWRALQIGEPVVLDDAEMERVFQQFRGYGQ
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
gtgagcggggcagggggccaccaggacttgcgcgaggcgatggtggccacctcgcggcgg
atgaacacgtccgggctgaaccagggcacctccggcaacctgagccagcgggtggagggc
ggcttcctcctcacgccgtccgggatgaactacgagacgatgacgccggaggacctggtc
ctcatgcgcttcgacggctcgcacgagggccaccgcaagccgtccaccgagtggcagctg
caccgggacatcctccaggcgcggccggaggtgggcgcggtgctgcacacgcacagcatg
ttcagcaccacgctggcgtgcctgcgccggggcatccccgccttccactacatggtgtcc
gcggcgggcggcacggacatccggtgcgcggagtacgcgacgtttggaacgccggagctg
gcgcggcacatgatggtggccctggagggccgcaaggcgtgcctgctggccaaccacggc
atggtcgccatgggcggggacctggcagcggcctggaagctggcggtggaggtggagacg
ctggcggccatgtattggcgcgcgctccagattggcgagcccgtggtgctggacgacgct
gaaatggagcgcgtgttccagcaattccgggggtatggccagtag

DBGET integrated database retrieval system