KEGG   Corallococcus coralloides: COCOR_07003Help
Entry
COCOR_07003       CDS       T01780                                 

Gene name
mtnD
Definition
acireductone dioxygenase
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
ccx  Corallococcus coralloides
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:ccx00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(8795835..8796380)
Genome map
AA seq 181 aa AA seqDB search
MSKLIVYNDHQPEAPLGVFTEPEDIRRELKPAGVRFERVNASVDLPEGAGQEEVLAAYKH
IVDAEMKAHGYNTVDVARIKPDAPNVEAARAKFLSEHAHTEDESRIMVEGSGCFYLHAGD
KVFQVECTRGDLISVPEGMKHWFDMGASPRFAAIRFFIRPDGWVGHFTGETIAERFPKYA
P
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagctgattgtctacaacgaccaccagccggaggcgccgctgggcgtcttcacc
gaaccggaggacatccgtcgcgagctgaagcccgcgggcgtgcgcttcgagcgagtgaat
gcatccgtggacctgccggaaggcgcgggccaggaagaggtcctcgcggcctacaagcac
atcgtggacgcggagatgaaggcccacggctacaacaccgtggacgtggcgcgcatcaag
ccggacgcccccaacgtggaggccgcccgcgcgaagttcctctccgagcacgcccacacg
gaggatgagtcgcgcatcatggtggagggcagcggctgcttctacctgcacgcgggcgac
aaggtcttccaggtggagtgcacgcgcggcgacctcatcagcgtgccggaaggcatgaag
cactggttcgacatgggcgcctcgccccggttcgccgccatccgcttcttcatccgcccg
gacggttgggtgggccacttcaccggcgagaccatcgccgagcgcttcccgaagtacgcg
ccgtga

DBGET integrated database retrieval system