KEGG   Corallococcus coralloides: COCOR_07034Help
Entry
COCOR_07034       CDS       T01780                                 

Gene name
aceB
Definition
(RefSeq) malate synthase
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
ccx  Corallococcus coralloides
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ccx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    COCOR_07034 (aceB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    COCOR_07034 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    COCOR_07034 (aceB)
Enzymes [BR:ccx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     COCOR_07034 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8843406..8845028
Genome map
AA seq 540 aa AA seqDB search
MDARTSQNPPAFGPGVTVEGAWHPDYAEVLTQEAMAFVAKLVRTFGERREALLERRKKVA
QGWRKGERPHFLPETADIRKGDWTVSPVPADLQDRRVEITGPVDRKMIINALNSGASVFM
ADFEDANSPTWDNVVRGQLNLRDAVRKTISFTAENGKHYALNDKHAVLFVRPRGWHLPER
HVRIDGKPISGSLFDFGLFFFHNAREQLKRGTGPYFYLPKMQSHLEARLWNDVFHLAQSE
LDIPRGTIKATVLIETLPAAFEMDEILYELREHSAGLNCGRWDYIFSFIKTLQSDASVVL
PDRGQVTMDKGFLNAYSQLLIQTCHRRGAHAMGGMAAFIPIKGDTAANDAVMAKVRADKL
REAKNGHDGTWVAHPGLVPVAREIFDAQMQGANQVANKREDVRITESDLLQLPSGTRTEE
GLRHNIRVGIQYTAAWLGGLGCVPLYNLMEDAATAEISRAQVWQWIHHEATLEDGRKVTP
ELFRKLLAEEMAQMGREGAVERYGQAHMEKSRALFEQLSTAPAFEDFLTLPAYEALDPQS
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atggacgcgcgcacctcccagaatcccccggccttcggccccggcgtgaccgtggagggc
gcctggcacccggactacgcggaggtgctgacgcaggaggccatggccttcgtggcgaag
ctggtccgcactttcggtgaacggcgggaagcactgctggagcggcgcaagaaggtggcg
cagggctggcgcaagggtgagcgcccccacttcctcccggagacggcggacatcaggaag
ggcgactggaccgtgtccccggtgcccgcggacctgcaggaccggcgcgtggagatcacc
ggtccggtggaccgcaagatgatcatcaacgcgctcaactccggcgccagcgtgttcatg
gcggacttcgaggacgccaacagccccacctgggacaacgtggtgcgcggccagctgaac
ctgcgcgacgccgtgcggaagaccatctccttcaccgcggagaacgggaagcactacgca
ctcaacgacaagcacgcggtcctcttcgtgcgcccgcgcggctggcacctgccggagcgc
cacgtgcgcatcgacggcaagcccatctccggctcgctcttcgacttcggcctgttcttc
ttccacaacgcgcgcgagcagctcaagcgcggcacgggtccctacttctacctgcccaag
atgcagagccacctggaggcccggctgtggaacgacgtgttccacctggcccagagcgag
ctggacatcccgcgcggcaccatcaaggccacggtcctcatcgagacgctgcccgccgcg
ttcgagatggacgaaatcctctacgagctgcgcgagcactcggccggcctcaactgcggc
cgctgggactacatcttcagcttcatcaagacgctccagtccgacgcgtccgtggtgctg
cccgaccgcgggcaggtgaccatggacaagggcttcctcaacgcctactcgcagctgctc
atccagacctgccaccgccggggcgcgcacgccatgggcggcatggccgccttcatcccc
atcaagggggacacggccgccaacgacgcggtgatggccaaggtccgcgcggacaagctg
cgcgaggcgaagaacggccacgacggcacctgggtggcgcaccccggcctggtccccgtg
gccagggagatcttcgacgcgcagatgcagggcgccaaccaggtggccaacaagcgcgag
gacgtgcgcatcacggagagcgacctgctccagctgccctccggcacgcgcacggaggag
ggcctgcgccacaacatccgcgtgggcatccagtacaccgccgcgtggctgggcggcctg
ggctgcgtgccgctctacaacctgatggaggacgcggccacggcggaaatctcccgcgcc
caggtgtggcagtggatccaccacgaggccacgctggaggacggccgcaaggtgacgccg
gagctgttccgcaagctgctcgcggaggagatggcgcagatgggccgcgagggcgctgtc
gagcgctacggccaggcgcacatggagaagtcccgcgccctcttcgagcagctgtccacc
gcgcccgccttcgaggacttcctcacgctgcctgcgtacgaggccctcgaccctcagtcc
tga

DBGET integrated database retrieval system