KEGG   Corallococcus coralloides: COCOR_07056Help
Entry
COCOR_07056       CDS       T01780                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
ccx  Corallococcus coralloides
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccx00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    COCOR_07056 (malQ)
Enzymes [BR:ccx01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     COCOR_07056 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8866437..8867990
Genome map
AA seq 517 aa AA seqDB search
MSTPGRLSGLLLPLFSLRSRTDFGIGDFGAMDGLFSWMKAARQRMLMVLPLLPTAPGDPS
PYATRSAFGLNPLFIDLNQVPEFQATGGESALSDAQKQQLAEARAAARVRYDLVFPLKDA
AFARAFDHFEQHEWAPRTPRAQEFQKWREAQGEWLESYALFTAISEKEDRRPWWQWPEGL
RTRQPDALRAIQEQGLERRVRYHAWLQWLAEAQWNQVRAQARAKDVLLCGDEPFIIGQDS
SDCWAHPDILRRDARLGVPPDDFSATGQDWGLPYFDFAAMEKDDYAWLKKRAAKAASYYD
LRRVDHAVGYFRQWIRDEKNPTGYFVPGDEPTWRRQGEKHFRLLSEGAGIVAEDLGVIPP
FVRQILADLKLPGYRVLRWERDDNTYRDPHAFPAVSLVTTGTHDTEPQAEWWEQAQEHER
QNAARAWPEFQGVALTREFTPDIHRATLAAALNAGSDLCVLPWQDVLGTRDRINLPGTMG
DANWAYRIAQNTDALLTEPQTKDAAERLAWLTASSRR
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgtccactcctggccggctctccggtctcctgctgcctctcttctccctgcgctcgcga
acggacttcggcatcggtgacttcggtgccatggacgggctcttctcctggatgaaggcc
gcgcgtcagcgaatgctgatggtgctgcccctcctgcccaccgcgcccggcgatcccagc
ccgtacgccacgcggtccgcgttcggcctgaacccgctcttcatcgacctgaaccaggtg
ccggagttccaggccaccggcggcgagagcgcgctcagcgacgcgcagaagcagcagctg
gcggaggcccgcgccgcggcgcgcgtgcgctacgacctggtgttcccgctgaaggacgcc
gcgttcgcgcgcgcgttcgaccacttcgagcagcacgagtgggcccctcgcacgccgcgc
gcccaggagttccagaagtggcgcgaggcgcagggcgagtggctggagagctacgcgctc
ttcaccgccatcagcgagaaggaggaccgccgtccctggtggcagtggcccgaagggctg
cgcacgcgccagccggacgccctgcgcgccatccaggagcagggcctggagcgccgcgtg
cgctaccacgcctggctccagtggctggcggaggcgcaatggaaccaggtccgcgcgcag
gccagggcgaaggacgtgctcctgtgcggagacgagcccttcatcatcgggcaggacagc
tccgactgctgggcccacccggacatcctgcgccgcgacgcgcgcctgggcgtgccgccg
gacgacttctccgccacgggccaggactggggcctgccctacttcgacttcgccgcgatg
gagaaggacgactacgcgtggctgaagaagcgcgcggccaaggcggccagctactacgac
ctgcgccgcgtggaccacgcggtgggctacttccgccagtggatccgcgacgagaagaac
cccaccggctacttcgtccccggagacgagcccacctggcgccgccagggtgagaagcac
ttccgcctgctgtcggagggcgcgggcatcgtcgccgaggacctgggcgtgattcccccg
ttcgtgcggcagatcctcgcggacctgaagctgcccggctaccgcgtgctgcgctgggag
cgcgacgacaacacctaccgcgacccgcacgccttccccgccgtgtcgctggtcaccacc
ggcacgcatgacacggagccgcaggcggagtggtgggagcaggcgcaggagcacgagcgc
cagaacgccgcgcgcgcgtggccggagttccagggcgtggcgctgacgcgcgagttcacc
ccggacatccaccgcgccacgctggccgccgcgctcaacgcgggctcggacctgtgcgtg
ctgccgtggcaggacgtgctgggcacgcgcgaccgcatcaacctgcccggcaccatgggc
gacgccaactgggcctaccgcatcgcgcagaacacggacgcgctgctcacggagccgcag
acgaaggacgccgcggagcgcctggcgtggctcaccgcctcgtcgcgccgctag

DBGET integrated database retrieval system