KEGG   Corallococcus coralloides: COCOR_07094Help
Entry
COCOR_07094       CDS       T01780                                 

Gene name
algC
Definition
(GenBank) phosphomannomutase/phosphoglucomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
ccx  Corallococcus coralloides
Pathway
ccx00010  Glycolysis / Gluconeogenesis
ccx00030  Pentose phosphate pathway
ccx00051  Fructose and mannose metabolism
ccx00052  Galactose metabolism
ccx00230  Purine metabolism
ccx00500  Starch and sucrose metabolism
ccx00520  Amino sugar and nucleotide sugar metabolism
ccx00521  Streptomycin biosynthesis
ccx01100  Metabolic pathways
ccx01110  Biosynthesis of secondary metabolites
ccx01120  Microbial metabolism in diverse environments
ccx01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ccx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    COCOR_07094 (algC)
   00030 Pentose phosphate pathway
    COCOR_07094 (algC)
   00051 Fructose and mannose metabolism
    COCOR_07094 (algC)
   00052 Galactose metabolism
    COCOR_07094 (algC)
   00500 Starch and sucrose metabolism
    COCOR_07094 (algC)
   00520 Amino sugar and nucleotide sugar metabolism
    COCOR_07094 (algC)
  Nucleotide metabolism
   00230 Purine metabolism
    COCOR_07094 (algC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    COCOR_07094 (algC)
Enzymes [BR:ccx01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     COCOR_07094 (algC)
    5.4.2.8  phosphomannomutase
     COCOR_07094 (algC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_III PGM_PMM_II PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: AFE08023
UniProt: H8MH61
Position
complement(8916969..8918339)
Genome map
AA seq 456 aa AA seqDB search
MNAHIFREYDIRGLVDKDLTIEVVELLGLGLGTMIRRKGGTSIVVGRDCRESSTRFRDAL
AKGLTATGLDVYDVGVVPTPLTYFAANTLPVDGLAMITGSHNPKEFNGFKIGAGKTTFHG
PEIKELRRLIEAKDFATSDKPGKVTPYDIITPYNHFIRQTVKVGRKGMKIVIDAGNGTGG
AIAVPLFESMGFDVVPLFCEMDADFPNHHPDPTVVENLQDLIKKVKEVKAEVGIAYDGDS
DRIGVIDDQGNVLWGDQLMVLFSRYVLKEAPGAAIIGEVKCSYTMYDDIAKHGGRPIMWK
AGHSLIKSKMKEEHAELAGEMSGHIFFKHRYFGFDDAVYASARLLEILTQEKQSMSQLLS
DVPKTFASPELRFDTTEEKKFAMVKRATEILRDAGHKVVDVDGVRVTFPDGWGLIRASNT
QPILVLRYEASTEARVKEIQALIEKTVAQAQKEVGA
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcgcacatcttccgcgagtacgacatccgaggtctggtggacaaggacctcacc
atcgaggtggtggagctcctgggcctgggcctgggcaccatgatccgccgcaagggcggc
acctccatcgtggtgggccgcgactgccgcgagtcctccacgcgcttccgcgacgcgctc
gcgaagggcctcaccgccaccggcctggacgtctacgacgtgggcgtggtgccgacgccg
ctgacctacttcgcggcgaacacgctgcccgtggacggcctggcgatgatcaccggcagc
cacaacccgaaggagttcaacggcttcaagattggcgccggcaagacgaccttccacggc
cccgaaatcaaggagctgcgccgcctcatcgaggcgaaggacttcgcgacctccgacaag
cccggcaaggtcacgccctacgacatcatcacgccctacaaccacttcatccgccagacg
gtgaaggtgggccgcaaggggatgaagatcgtcatcgacgcgggcaacggcacgggcggc
gccatcgcggtgcccctgttcgagagcatgggcttcgacgtggtgcccctgttctgcgag
atggacgcggacttccccaaccaccacccggaccccacggtggtggagaacctccaggac
ctcatcaagaaggtgaaggaggtcaaggcggaggtgggcatcgcgtacgacggcgacagc
gaccgcatcggcgtcatcgacgaccagggcaacgtgctctggggggatcagctgatggtg
ctcttcagccgctacgtgctgaaggaggccccgggcgcggccatcatcggcgaggtgaag
tgcagctacacgatgtacgacgacatcgcgaagcacggcggcaggcccatcatgtggaag
gcgggccactccctcatcaagtcgaagatgaaggaggagcacgcggagctggccggagag
atgagcggccacatcttcttcaagcaccgctacttcggcttcgacgacgcggtgtacgcg
tccgcgcgcctgctggagattctgacgcaggagaagcagtccatgtcgcagctgctctcc
gacgtgccgaagaccttcgccagccccgagctgcgcttcgacacgacggaggagaagaag
ttcgccatggtgaagcgcgccacggaaatcctgcgcgacgcgggccacaaggtggtggac
gtggacggcgtgcgcgtgacgttcccggacggctgggggctcatccgcgcgtcgaacacg
cagcccatcctggtgctgcgctacgaggccagcacggaggcccgcgtgaaggagatccag
gcgctcatcgagaagacggtcgcccaggcgcagaaggaagtcggcgcctga

DBGET integrated database retrieval system