KEGG   Corallococcus coralloides: COCOR_07354Help
Entry
COCOR_07354       CDS       T01780                                 

Definition
alpha/beta fold family hydrolase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
ccx  Corallococcus coralloides
Brite
Enzymes [BR:ccx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     COCOR_07354
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9222594..9223457
Genome map
AA seq 287 aa AA seqDB search
MASVLPVSTRWRDIDGESTAPFALGRGPDACLLLHGFTGSPWEVRPLGEALAARGMRVVA
PRLPGHGTTPEAMLDVDFRDWQACADEALASLSGHRRVFVAGLSMGALLALRLAAHQPEA
VHALALVAPAVRFRGARMALVRQLCRTPLLEWTTPWVDKGGTDISDPATLAQAPVLPAFP
VARLRDLCRLQDLALADAPRVRCPVLVATAEQDHVVDPEGGRWLARRMKACPEVRHVAYR
EGFHIIPRDVCGARLAREVGDFLQPWRAEEDVRSPADWAEGQDAPPP
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
gtggccagtgtcctccctgtgagcacgcgctggcgggacatcgacggggagtccaccgcg
cccttcgccctggggcggggacctgacgcctgcctgctgctgcatggcttcaccggcagc
ccgtgggaggtgcgtcccctgggcgaggccctggcggcgcgagggatgcgcgtggtggcg
cccaggcttccgggccatggcaccacgccggaggcgatgctggacgtggacttccgcgac
tggcaggcctgcgcggacgaggcgctggcgtcgctctccggacaccgccgcgtgttcgtc
gccggactgtccatgggcgcgctgttggcgctgcggctggccgcgcatcaaccggaagcg
gtgcacgcgctcgcgctggtggcgcccgcggtgcgcttccggggcgcgcgcatggcgctg
gtgcgccagctgtgcagaacgccgctgctcgaatggaccacgccgtgggtggacaagggc
ggcacggacatctccgacccggccacgctggcgcaggcgccggtgctgcccgcgttcccg
gtggcccggctgcgcgacctgtgcaggctgcaggacctggcgctggcggacgcgccccgg
gtgcgctgcccggtgctggtggccaccgcggagcaggaccacgtggtggatccggagggc
ggacgctggctcgcgcggcggatgaaggcgtgtcccgaggtgcggcacgtggcctatcgg
gagggcttccacatcatcccgcgcgacgtgtgcggggcgcggctcgcccgggaggtgggg
gacttcctccagccgtggcgcgcggaggaggacgtcaggagcccggcggattgggcggag
gggcaagacgcgccaccgccgtga

DBGET integrated database retrieval system