KEGG   Corallococcus coralloides: COCOR_07522Help
Entry
COCOR_07522       CDS       T01780                                 

Gene name
cheB4
Definition
protein-glutamate methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
ccx  Corallococcus coralloides
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:ccx00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    COCOR_07522 (cheB4)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    COCOR_07522 (cheB4)
Enzymes [BR:ccx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     COCOR_07522 (cheB4)
Two-component system [BR:ccx02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   COCOR_07522 (cheB4)
Bacterial motility proteins [BR:ccx02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    COCOR_07522 (cheB4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9413920..9414987
Genome map
AA seq 355 aa AA seqDB search
MKTEPLRILVAEDSPTARRLLVEILRTDPALTVVGEARDGLEAVELCQRLQPALVTMDIQ
MPRMDGLDATRRIMTEVPTPVVVVSTLVERDIQTSMAALRAGALAVLQKPVGPESPDFEA
DSRRLRDTLKAMAQVKVVRRWPDRTATPPPSPESTPTPGARPPAVLAMAASTGGPAALYR
ILSDLSGRDTPPPPILLVQHIALGFGSGLATWLGTATKLLVKVAEDGEPLMPGTVYLAPD
DKHLGVTMDYRAQVSGAAPIQGFRPSANWLFRSVARAYGQTALAVVLTGMGQDGLDGIRD
LHQAGGRVIAQDEATSVVYGMPAVVVGANLAHEVLPLGQIARRLLALLQPTGRLT
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgaagaccgaaccgttgcgcatcctggtggccgaggactcgcccaccgcccggcggctg
ctggtggaaatcctgcgcaccgacccggcgctcaccgtggtgggcgaggcccgggacggc
ctggaggcggtggagctgtgccagcgattgcagcccgcgctggtgacgatggacatccag
atgccgcgcatggacggcctggacgccacccgccgcatcatgacggaggtgcccacgccg
gtggtggtggtgtccacgctggtggagcgcgacatccagacgtccatggccgcgctgagg
gccggggcgttggcggtgctccagaagccggtgggcccggagtcgccggacttcgaggcg
gacagccgccgcctgcgcgacacgctcaaggccatggcccaggtgaaggtggtgcgccgc
tggccggaccgcaccgccacgccgccgccctcgccggagtcgacgcccacgcccggcgcc
cgcccgcccgccgtgctggcgatggccgcgtccaccggaggccccgccgcgctctaccgc
atcctgtccgacctgagcggcagggacacgcccccgccccccatcctgctggtgcagcac
atcgcgctgggcttcggctccggcctggccacgtggctgggcacggccacgaagctgctc
gtgaaggtggccgaggacggcgagcccctcatgcccggcaccgtgtacctggccccggac
gacaagcacctgggtgtcaccatggactaccgcgcgcaggtgtccggcgccgcgcccatc
cagggcttccgcccgtccgccaactggctcttccgcagcgtggcccgcgcctatgggcag
acggccctggcggtggtgctcaccggcatggggcaggacggcctggacggcatccgggac
ctgcaccaggcaggcgggcgggtgatcgcccaggacgaggcgacgtccgtcgtctacggc
atgcccgccgtggtggtgggcgccaacctggcgcacgaggtcctgccgctcgggcagatc
gcgcggcggctgctggcgctgctccagcccacgggtcggctcacctga

DBGET integrated database retrieval system