KEGG   Corallococcus coralloides: COCOR_07743Help
Entry
COCOR_07743       CDS       T01780                                 

Definition
putative asparagine synthetase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
ccx  Corallococcus coralloides
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ccx00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    COCOR_07743
Enzymes [BR:ccx01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     COCOR_07743
Peptidases [BR:ccx01002]
 Cysteine Peptidases
  Family C44
   COCOR_07743
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9674221..9675726
Genome map
AA seq 501 aa AA seqDB search
MPTRAPKVSPAGKAPSRGLSPRAVGDLLFHARASNADLQLEAVPLGVTLPRVLREAEARD
EEELAARLLSAWSDTVRAHVEAGTHDVSLSGGVDSAALCAMAARHAPQKVRAWTMDVHFA
DAVERSNARRMAKVTGAELVDVLIPDSVLPDLFEHAVLANQTVILNARAVASYVFYLEAQ
RQGAGPVLLSGAGADEVLQGTPGVLAAAKARVDEDRTLAVRALGFEAMAAVDNLRAPFRA
GSRDHEEPPGAARGAVDNSGSPLDGAPHGDQESKPSTGHFPSGNGGSDQALGRREDSTPV
DNLRTVSEGWNSDHVSRGPPVDNLGTGLAAPWELPQEEALPSEELRYAKWVLAELILPPE
LRGARAHGLTVRTPYLDEGFARVALALPESVLQRDGFGKWLFRHAVRSLVPDEVRLARKT
PRYGHTALSSPVRSRWLELYRAWLSPARLDSLQVINTQGVLGLMERYFRLPPDDAQAGPM
DRLLMRLMSLAMLQAHTKAPP
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgccgacccgcgctcccaaggtgtcccctgcaggaaaggctccctcgcgcggcctgtca
cctcgtgcggtaggcgacctgctgttccatgcccgagcatccaacgcggacttgcagttg
gaggcggtgcccctcggcgtgacgctgccgcgagtcctccgggaagcggaggctcgggac
gaagaagagctcgcggcgcggctgttgtccgcctggtccgacaccgtgcgggcacatgtc
gaagcgggcacgcacgacgtgagcctgagcggcggcgtggacagcgcggccctgtgcgcg
atggccgcgcggcatgcaccgcagaaggtgcgtgcgtggacgatggacgtgcacttcgcg
gacgcggtggagcggagcaacgcgcggcggatggcgaaggtgacgggcgcggagctggtg
gacgtgctcatcccggactccgtgctcccggacctgttcgagcacgcggtcctcgccaac
cagaccgtcatcctcaacgcccgggccgtggccagctacgtgttctatctggaggcccag
cggcagggcgcgggccccgtcctcctgagcggcgcgggagcggacgaagtgctccagggc
accccgggcgtgctcgccgccgcgaaggcccgcgtggacgaagaccggacgttggccgtg
cgggccctgggcttcgaagccatggcggctgtggacaacttgcgggcgccgttccgagcc
ggctcgcgcgatcatgaagagccccccggagcggcacggggggctgtggacaactcggga
agccctctggacggggccccgcacggcgatcaggaatcaaagccatccacggggcatttc
ccctctggaaacggcggttccgatcaagccttgggacgccgtgaagactccacacctgtg
gacaacttgaggactgtttccgagggctggaacagcgatcacgtctcgcgaggcccccct
gtggacaacctggggaccgggctcgccgcgccgtgggagctgcctcaggaggaggcgctc
ccctccgaggagctgcggtacgcgaagtgggtgctggccgagctcatccttccccccgag
ctgcggggcgcccgggcccatgggctcacggtccgcacgccatacctggacgaaggcttc
gcgcgggtggcgctggcgctgccggagtccgtgctgcaaagggacgggttcggcaagtgg
ctgttccggcatgcggtgcggtccctggtgccggacgaggtccgcctcgcgcgcaagacg
ccccggtatggacacaccgccctctccagcccggtgcggtcgcgctggctggagctgtat
cgcgcctggctctctcccgcgcggctggactccctccaggtcatcaacacacaaggggtg
ctgggattgatggagcgctacttccggctgccgcccgacgacgcgcaggccggaccgatg
gatcggttgttgatgcgcctcatgtccctggccatgctccaggcccacaccaaggcgccc
ccctga

DBGET integrated database retrieval system