KEGG   Chthonomonas calidirosea: CCALI_00041Help
Entry
CCALI_00041       CDS       T02699                                 

Definition
Glutamate dehydrogenase/leucine dehydrogenase (EC:1.4.1.3)
Orthology
K00261  
glutamate dehydrogenase (NAD(P)+) [EC:1.4.1.3]
Organism
ccz  Chthonomonas calidirosea
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Nitrogen metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccz00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    CCALI_00041
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CCALI_00041
   00330 Arginine and proline metabolism
    CCALI_00041
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    CCALI_00041
Enzymes [BR:ccz01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.3  glutamate dehydrogenase [NAD(P)+]
     CCALI_00041
Exosome [BR:ccz04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   CCALI_00041
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(37726..39057)
Genome map
AA seq 443 aa AA seqDB search
MSTQTVTTAENPLPSMDRQHMTTALSEPLESTNPYENALHQLDIAARYLELDPGLHEILK
HPERELTVHFPVKMDDGSIRIFTGYRVQHNLARGPSKGGIRFSPKTDLDEVRALAMWMTW
KCAIVNIPFGGAKGGVVCDPKTLSIGELERLTRRYTSEISIVIGPDTDIPAPDMGTNAQI
MAWVMDTYSMSCGRTVPAVVTGKPVSVGGSEGRNDATGRGIVVMAREALREYGRQLQGAT
VAIQGFGNVGSAAAKIFHQMGAKVVAVSDALGGIYNPNGLDIPALQECANRDGTLTTHTG
GEKIGGKELLELEVDVLVPAAVENQITTENAGRIRAKIIVEGANGPTTPAADRILHQRGI
FLVPDVLANAGGVVVSYFEWVQDLQFFFWQEEEVNAKMEAIMERAYRDVRSMARREDVDM
RLAAYLIGVRRVADATTTRGIYP
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
ttgagcacacaaaccgtaacaacggcagaaaaccctctgccttccatggaccgacagcac
atgacaaccgctctctccgaacctcttgaaagcaccaatccctacgaaaacgcccttcat
cagcttgacatcgcagcccgttatctcgaactcgaccccggcctacacgaaatcttgaaa
catccggaacgcgagctcaccgttcacttccccgttaaaatggacgatggctccatcaga
atcttcacgggctatcgtgtgcagcacaaccttgcccgagggccaagcaaaggaggcatt
cgcttcagccccaaaacagaccttgatgaggtgcgcgcgcttgccatgtggatgacatgg
aagtgcgccatcgtcaacatcccctttggcggagccaaaggcggtgtggtctgtgacccc
aaaacgctctcgataggcgagttagagaggcttacacgtcgttacacctcagagatcagc
atcgtcataggcccggataccgacattccagcgcccgacatgggcaccaacgcccagatc
atggcatgggtcatggatacctactccatgagctgtgggcgcacggttcctgccgtcgtc
acgggcaaacccgtctccgtgggcggctctgaagggcgcaacgatgccacggggcgaggc
atcgtggtgatggcccgcgaggcgctgcgagagtacggtcgccaactgcagggggccacg
gtagcaattcaaggctttggaaacgtaggcagcgctgctgccaaaatcttccaccagatg
ggggccaaagtggtggccgtaagcgatgcgctcggcggcatctacaaccccaacgggctt
gacattcccgctctgcaagagtgcgctaaccgcgacggcaccctgaccacgcacaccggc
ggcgagaagataggtggcaaagagctgcttgagctagaagtggatgtgcttgtgccagct
gccgttgaaaaccagatcaccacagaaaatgccgggcgcatccgcgcaaaaattattgta
gagggcgccaatggccccaccacaccggcggcagaccgtattctccaccaacgcggtatc
tttctcgtccccgatgttctggctaacgccggtggtgttgtggtctcctatttcgaatgg
gtgcaagatctgcagttcttcttctggcaagaagaggaggtcaatgcaaaaatggaggcc
attatggaacgggcctatcgcgatgtgcgcagcatggcgcgccgtgaagacgtggatatg
cgcctcgctgcttacctcattggagtgagacgcgttgccgatgccaccaccacgcgaggc
atctatccctaa

DBGET integrated database retrieval system