KEGG   Chthonomonas calidirosea: CCALI_00041Help
Entry
CCALI_00041       CDS       T02699                                 

Definition
Glutamate dehydrogenase/leucine dehydrogenase (EC:1.4.1.3)
Orthology
K00261  
glutamate dehydrogenase (NAD(P)+) [EC:1.4.1.3]
Organism
ccz  Chthonomonas calidirosea
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Nitrogen metabolism
Metabolic pathways
Class
Metabolism; Energy metabolism; Nitrogen metabolism [PATH:ccz00910]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:ccz00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:ccz00330]
Metabolism; Metabolism of other amino acids; D-Glutamine and D-glutamate metabolism [PATH:ccz00471]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(37726..39057)
Genome map
AA seq 443 aa AA seqDB search
MSTQTVTTAENPLPSMDRQHMTTALSEPLESTNPYENALHQLDIAARYLELDPGLHEILK
HPERELTVHFPVKMDDGSIRIFTGYRVQHNLARGPSKGGIRFSPKTDLDEVRALAMWMTW
KCAIVNIPFGGAKGGVVCDPKTLSIGELERLTRRYTSEISIVIGPDTDIPAPDMGTNAQI
MAWVMDTYSMSCGRTVPAVVTGKPVSVGGSEGRNDATGRGIVVMAREALREYGRQLQGAT
VAIQGFGNVGSAAAKIFHQMGAKVVAVSDALGGIYNPNGLDIPALQECANRDGTLTTHTG
GEKIGGKELLELEVDVLVPAAVENQITTENAGRIRAKIIVEGANGPTTPAADRILHQRGI
FLVPDVLANAGGVVVSYFEWVQDLQFFFWQEEEVNAKMEAIMERAYRDVRSMARREDVDM
RLAAYLIGVRRVADATTTRGIYP
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
ttgagcacacaaaccgtaacaacggcagaaaaccctctgccttccatggaccgacagcac
atgacaaccgctctctccgaacctcttgaaagcaccaatccctacgaaaacgcccttcat
cagcttgacatcgcagcccgttatctcgaactcgaccccggcctacacgaaatcttgaaa
catccggaacgcgagctcaccgttcacttccccgttaaaatggacgatggctccatcaga
atcttcacgggctatcgtgtgcagcacaaccttgcccgagggccaagcaaaggaggcatt
cgcttcagccccaaaacagaccttgatgaggtgcgcgcgcttgccatgtggatgacatgg
aagtgcgccatcgtcaacatcccctttggcggagccaaaggcggtgtggtctgtgacccc
aaaacgctctcgataggcgagttagagaggcttacacgtcgttacacctcagagatcagc
atcgtcataggcccggataccgacattccagcgcccgacatgggcaccaacgcccagatc
atggcatgggtcatggatacctactccatgagctgtgggcgcacggttcctgccgtcgtc
acgggcaaacccgtctccgtgggcggctctgaagggcgcaacgatgccacggggcgaggc
atcgtggtgatggcccgcgaggcgctgcgagagtacggtcgccaactgcagggggccacg
gtagcaattcaaggctttggaaacgtaggcagcgctgctgccaaaatcttccaccagatg
ggggccaaagtggtggccgtaagcgatgcgctcggcggcatctacaaccccaacgggctt
gacattcccgctctgcaagagtgcgctaaccgcgacggcaccctgaccacgcacaccggc
ggcgagaagataggtggcaaagagctgcttgagctagaagtggatgtgcttgtgccagct
gccgttgaaaaccagatcaccacagaaaatgccgggcgcatccgcgcaaaaattattgta
gagggcgccaatggccccaccacaccggcggcagaccgtattctccaccaacgcggtatc
tttctcgtccccgatgttctggctaacgccggtggtgttgtggtctcctatttcgaatgg
gtgcaagatctgcagttcttcttctggcaagaagaggaggtcaatgcaaaaatggaggcc
attatggaacgggcctatcgcgatgtgcgcagcatggcgcgccgtgaagacgtggatatg
cgcctcgctgcttacctcattggagtgagacgcgttgccgatgccaccaccacgcgaggc
atctatccctaa

DBGET integrated database retrieval system