KEGG   Chthonomonas calidirosea: CCALI_00062Help
Entry
CCALI_00062       CDS       T02699                                 

Definition
hopanoid-associated sugar epimerase (EC:1.1.1.219)
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
ccz  Chthonomonas calidirosea
Brite
Enzymes [BR:ccz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydrokaempferol 4-reductase
     CCALI_00062
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(63199..64209)
Genome map
AA seq 336 aa AA seqDB search
MPSLVTGATGFVGFHVARLLTARGQPIRVLTRPTSRRENLCALNPALYEEVCGDLTDIAS
LRKAVAGCDVVYHVAADYRLWARDPQQLYRANVEGTKNLLTAARDAGVRRVVYTSTVGVL
GIPRDGSPGNEDTPVSLADMIGHYKRSKFLAEEVARQFAAEGLDVVIVNPSTPVGENDIK
PTPTGRIIVDFLNRRLPAYVDTGLNLVDVRDVAEGILLAAEKGRTGQRYILGHRNVTLRQ
MLEMLAQISGLPAPRLRLPYAIAWCAVGLENLLVARLLKKEPTHPFEGVKMARYKMYFDS
TRAVRELGMPQSPIEDALARAVAWFQEKGYAKKQKP
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgccttcgctggttaccggtgccaccggcttcgtcggctttcacgtggcccgtctcctt
acagcacgcggccaacctattcgggtgcttacccgcccgacgagtcgtcgcgagaacctg
tgcgctcttaacccggcgctctacgaagaggtgtgcggcgatctaaccgatatcgcctca
cttcgcaaagcagtagccggttgcgatgtggtctaccacgtggcagcggactatcgcctg
tgggcgcgagacccgcaacagctgtaccgagccaacgtagagggcacaaaaaacctcttg
accgcagctcgtgatgccggcgtaaggcgcgtggtctatacgagcaccgtgggggtactg
ggtatccctcgcgacggttcgcccggaaatgaagacacaccggtatctctggccgatatg
atcggccactacaaacgctcgaaattcttggccgaggaggtcgcccgacaattcgcagca
gaagggctcgatgtggttatcgtgaatccgagcacgcccgtgggagaaaacgatatcaaa
ccgaccccaacaggccgtattatcgtggattttcttaaccggcgtctgcccgcttacgta
gacaccggtctcaacctcgtggatgtgcgagacgtggcagaaggcatcctgctagccgcg
gaaaagggacgcaccggtcaacgttacatcctcggccatcgtaatgtaactttgaggcag
atgttagaaatgctcgcccagatatcggggctacctgctccgcgccttcgtctgccttat
gccattgcctggtgcgccgtaggcctcgaaaaccttctggtcgcacgtttattaaaaaaa
gagccgacacaccccttcgaaggggtgaaaatggcccgatataaaatgtacttcgactca
acgcgcgctgtgcgggaattgggaatgccccaatccccaatcgaagacgctctcgcccgc
gcagtggcttggtttcaggagaaaggttatgccaaaaaacaaaaaccataa

DBGET integrated database retrieval system