KEGG   Chthonomonas calidirosea: CCALI_00711Help
Entry
CCALI_00711       CDS       T02699                                 

Definition
Predicted sugar isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
ccz  Chthonomonas calidirosea
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccz00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CCALI_00711
   00051 Fructose and mannose metabolism
    CCALI_00711
Enzymes [BR:ccz01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     CCALI_00711
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(818080..819201)
Genome map
AA seq 373 aa AA seqDB search
MRVNSENLALLSSQFRGYLEGERVDQFFETYGIQFSAGHWCAGGFSDRFCRSYAETPLDE
SAVGQIARVAEAGIKGIELNNEMFLDEHLQIDDNAIRTVQQALQAHGLIATNMNTNIWTR
ARFRMGSITNPDPGRRREALEYCLQTVEIAKRVGTRSVQLWPGSDGWDYHFEVNYGKQLD
WFIEGCVEIARKANSYGLLFGTEAKQKEPREGNMILNTTAKAALVAKTVNETLGTTAMGV
VIDYGHEQMVGNQPADSLYLLKRMAVPIANFHINAAKYNSNDEDRVTGTDDIWRLAEFCY
AAVDTGYEGWFGEDQFTYRMDPVRAMRLSKELFANAMKKALAIYSIRDKLQQAQESGEVA
NVIDVVKRILTCE
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgttaacagtgagaaccttgcattgctctcttctcaattccgtggctatctcgaa
ggtgagcgggtagaccagttttttgagacctatggtattcagttttcggccggccattgg
tgtgctggcgggttcagcgatcggttctgccgttcctatgccgaaacccctctcgatgag
agcgcggtcgggcagatcgcgcgtgtagcggaagccggcattaaggggattgagctgaac
aatgagatgttcctggatgagcacctgcagattgacgataacgccatccgtaccgttcaa
caggcgttgcaagcacatggcctgatcgcgaccaacatgaacacaaatatctggacaaga
gcgcgtttccggatgggtagcattacgaaccccgatcccggacgtcgtcgtgaggcgctg
gaatattgcctgcagacggtggagatcgccaagcgagtcggcacgcgcagcgtgcagctg
tggcccggttcggatggatgggactaccattttgaggtgaactacggaaaacagctcgat
tggtttatcgaagggtgcgtggagatcgcacgaaaagccaacagctacggtctgctattc
ggcaccgaggccaagcaaaaagagccgcgcgaaggcaacatgatcctcaataccactgcg
aaagcagcgctcgtagctaagaccgtgaacgagactttggggacaaccgctatgggggtg
gtgatagactatggccatgagcagatggtgggtaaccagcccgccgatagcctctatctg
ttgaagcgtatggcagtgcccatcgccaacttccatatcaatgccgcaaagtacaattcg
aacgacgaggatcgcgtaacgggcaccgacgatatctggcgccttgccgagttctgctat
gctgcagtggatacgggctatgagggttggtttggtgaggatcaatttacctaccgcatg
gatcccgttcgagcgatgcggctttccaaggagctgtttgcgaacgccatgaagaaggcg
cttgccatctattccatacgtgataaattacagcaagcgcaggaatcgggggaggtggcg
aatgtgattgatgtggtaaagcgcatccttacctgcgaatag

DBGET integrated database retrieval system