KEGG   Chthonomonas calidirosea: CCALI_00940Help
Entry
CCALI_00940       CDS       T02699                                 

Definition
aminopeptidase. Metallo peptidase. MEROPS family M42 (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
ccz  Chthonomonas calidirosea
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ccz00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1101488..1102558)
Genome map
AA seq 356 aa AA seqDB search
MDFELLKTLCETPGIPSREEPIRRVVAEALRPLVDALEVDAMGNLIGHRRGEEGGPRVMI
AAHMDEIGFMVKHIDSRGFLKLLPVGGWDPRNLVSQRVFVHSRSGQRLPGVLMPGTKPPH
LQTPEESNKALKIEDMFVDLGLPGEKVKELVEIGDMVTMDRTCERVGDTVVSKTLDDRLM
VFVMIEALRKLERRVPAHIFAVATTQEEVGLRGATTAAFALEPNIGIALDVTLAVDFPGA
PESEQVTRLGEGVAIKIVDSSLICHPKLVRHFRDVAEQRQIKYQLEMLPRGGTDAGGIQR
SRGGVPSFTLSVPVRYVHTVNEMAHVEDIQGAINLLAAYLEEAHTRHYDYRDELSG
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
ttggatttcgaactgctaaaaacactgtgtgaaacgccggggattcctagtcgggaagag
ccgattcgtcgggtggtagcggaagcccttcgccccttagtagacgctctcgaggtggat
gccatgggcaatcttatcggccataggcgcggcgaggagggggggccgcgcgtgatgatc
gcggcgcatatggatgaaataggcttcatggtcaagcatattgatagtcgtggcttcctg
aagcttctgcccgttggcggctgggaccctcgtaatttggtgtcgcagcgggtgttcgtg
cattcgcgttcgggacagcgattgcctggggtgctgatgccaggcaccaagccgccgcac
ctacagacgccggaagagagcaacaaagctctgaaaatagaggacatgtttgttgatctg
gggttgccgggcgagaaggtgaaggagctggtggagatcggcgatatggtgacgatggat
cgcacgtgcgagcgtgtgggcgatacggtggtaagcaaaacactcgacgaccgccttatg
gtttttgtgatgatcgaggctctgcggaaactagagagacgcgtgcccgcccatatcttc
gctgtggctaccacccaagaggaggtgggcttgcgaggggccaccacagcggctttcgcc
ttagagccgaatattgggatcgccttggatgttacgctggccgttgatttcccgggcgct
cccgaatcggagcaagttacccgtttgggcgagggggttgccatcaagatcgtcgactcc
tctctgatctgtcatcctaaactcgtgcgccattttcgcgatgtggcggaacagcggcag
attaagtatcagctcgaaatgctgccaagagggggcacggatgcgggcggcatacagcgt
agccgaggcggagtgccttcctttacgctctcggttccggtgcgctatgttcacaccgtg
aacgagatggcgcatgtggaggacattcagggcgccatcaatctgcttgccgcctacctt
gaggaagcgcatacacgccactacgactatcgtgatgagttgagcggttaa

DBGET integrated database retrieval system