KEGG   Chthonomonas calidirosea: CCALI_01160Help
Entry
CCALI_01160       CDS       T02699                                 

Definition
thymidine kinase (EC:2.7.1.21)
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
ccz  Chthonomonas calidirosea
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccz00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    CCALI_01160
Enzymes [BR:ccz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     CCALI_01160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1354749..1355441
Genome map
AA seq 230 aa AA seqDB search
MPTRTKQPGSITVICGCMFSGKTDELIRLVRRALYARKRVQVFKSALDTRTDNTVISTHD
GVRFQAIAVPDARTLEALLDPRVHVVGIEEVQFFDEAIVPLCQRLADRGTEVIVAGLDQD
FRGMPFGVMPTLLALAENVIKLHAICKVCGGEATRTQRLVNGRPASWNEPTILIGAEETY
EARCRRCHRVRNAPIHSARGTHPMPPTRTPEVTDPRQLEMFMEPEVDNEG
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgcctacgcgcaccaaacagcccggctctatcacggttatctgcgggtgtatgttctca
ggaaaaactgacgagctcattcggcttgtacggcgagccctctacgcccgcaaacgggta
caggtttttaaatcggccctcgatacgcgcaccgataacaccgttatcagcacccatgac
ggcgtacgttttcaggccattgccgtgcccgatgcccgtaccctcgaggcgcttctagac
ccacgcgtccatgtggtgggcattgaagaggttcaattcttcgacgaggccattgttccc
ctctgtcagcgtctcgccgatcgaggcacagaggtgattgtagccggcctcgatcaggat
tttcgtggcatgcccttcggcgttatgcccaccctcctggcgctcgccgagaacgttatc
aagctgcacgctatctgcaaggtctgtggcggagaggccacccgcacacagcgcctcgtg
aacggacgccccgcatcctggaacgaacccaccattcttatcggagcagaggagacctac
gaggcgcgctgccgccgttgccatcgcgtgcgcaacgcccccatccacagcgcccgtggt
acccaccctatgcctcctacccgcaccccagaagttaccgatcctcgtcaactcgaaatg
tttatggagccggaggtagacaacgaaggctag

DBGET integrated database retrieval system