KEGG   Chthonomonas calidirosea: CCALI_01850Help
Entry
CCALI_01850       CDS       T02699                                 

Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
ccz  Chthonomonas calidirosea
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:ccz00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CCALI_01850
Enzymes [BR:ccz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     CCALI_01850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2192959..2193891
Genome map
AA seq 310 aa AA seqDB search
MEFPITVVGSANVDMIMQVERFPAPGETVSDGQFSQAFGGKGANQAVAAARAGGRVAFLG
CVGADAFGEAILENLRRDGIFTEPVVKSVSEPTGIAMILINKQGENCIAAAPGANNALTS
AHIESYAAFLKRSRMVVIQAEIPRIAVEKTFEVLADSETAILFNFAPIRKEAPKLSPRIT
YLVVNETEAAYLSGVQVGTFREAEQAARILRRQGPQNVLLTLGANGVWVETPQGGFHAPA
LPVQAIDTTAAGDVFCGAFATATTQGQPIHEAVHFACAAAALCVTRLGAQPSIPYREEVE
TLLKQQSPCS
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atggagtttccaattactgtggttggcagcgcaaatgtggatatgatcatgcaggtggag
cgatttccggcgccaggggagacggtgagtgacggccagttttcgcaggctttcggaggc
aaaggggccaaccaagccgtcgctgcagcgcgtgctggagggagggttgcttttttagga
tgtgttggggccgatgcctttggcgaggccattctggaaaacctccggagagatggcatt
tttaccgaaccagttgttaagagtgtttcggaaccaaccggcattgcgatgatcctgatc
aacaagcaaggcgagaactgcattgcagctgctccaggcgccaacaacgccttaacctcc
gcgcatatcgagagttatgcggctttcctgaagcgcagccgcatggtggtaatacaggca
gagattccacgcatcgctgtggaaaaaaccttcgaggtgttggccgactctgaaacggcc
atcctgtttaacttcgcccccattcgtaaagaggctcccaaactttccccacggatcacc
tacctcgtagtcaatgaaaccgaagcggcctaccttagcggcgtgcaggtcggcactttc
cgcgaggcggagcaggccgcccggattctacgaagacaagggccccaaaatgtgctcctc
acgttaggggccaacggtgtgtgggtcgaaacgcctcaaggcggctttcatgccccagcg
ctccctgtgcaggcgatagatactactgccgccggcgatgtgttctgcggtgcattcgcc
acggcgactacacagggacagcccatccacgaggccgtgcactttgcctgtgcagctgca
gctctctgcgttacccgtttgggtgcccagccctctattccgtatcgtgaggaggtagag
accttacttaagcagcaaagcccctgttcttag

DBGET integrated database retrieval system