KEGG   Chthonomonas calidirosea: CCALI_02206Help
Entry
CCALI_02206       CDS       T02699                                 

Definition
Catalase (EC:1.11.1.6)
Orthology
K03781  
catalase [EC:1.11.1.6]
Organism
ccz  Chthonomonas calidirosea
Pathway
Tryptophan metabolism
Glyoxylate and dicarboxylate metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ccz00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    CCALI_02206
  Amino acid metabolism
   00380 Tryptophan metabolism
    CCALI_02206
Enzymes [BR:ccz01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     CCALI_02206
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2603339..2604832)
Genome map
AA seq 497 aa AA seqDB search
MPEDKEHPILTTADGAPIADNQNALTAGPRGPLLMQDIQLLEQMQHFNRERIPERVVHAK
GSGAYGTFTVTNDITRYSKAKLFSEVGKQTPIFIRFSTVAGERGAADAERDVRGFAIKFY
TEEGNWDLVGNNTPVFFVRDPYKFQMFIHTQKRDPRTNLRDMDMQWDFWSLCPESLHQVT
ILFSDRGIPRSYRHMNGYGSHTYSLINEKGERVWCKFHIKTMQGIQCLTDEEAERIIGKD
RESHQRDLFETIERGEFPRWKMYIQVMTDEQAKNFRWNPFDLTKVWPHAEYPLIEVGILE
LNRNPENYFAEVEQAAFSPSAIVPGISWSPDKMLQARLMSYADAHRYRVGNNYHQLPVNR
PRCPVKNYQRDGFMTHGEYGAAPNYFPNSREGTPQPAPEYKEPAWYLGDVTVDRYDSTKD
HDDYTQPGNLYRLFDEGQRERLTTAIAKALGQARKEVQLRQLAHFFRADEDYGRRVAQKL
GIDPSEIPGLVSATTAR
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaagacaaagaacaccccattcttaccaccgccgacggcgcccctatcgccgac
aaccaaaatgccctcaccgccgggccgcgtggccccctgctgatgcaagacatccagctg
ctcgaacagatgcagcacttcaatcgagagcgcatccctgagcgggtcgttcacgcaaaa
ggctccggcgcctacggcacctttaccgttaccaacgacattactcgctactctaaagcc
aagctcttctctgaggtcggcaagcagacacccatctttattcgtttctccacggtagcc
ggtgagcgcggtgcagccgatgcggagcgcgacgttcgaggctttgccattaaattctac
acggaggaaggcaactgggacctcgtgggcaacaacactcccgtcttcttcgtgcgcgac
ccctacaagtttcaaatgtttatccacacgcaaaagcgcgatccgcgtaccaacctccgc
gatatggatatgcagtgggacttctggtcgctctgccccgaatcgctgcaccaggttacc
atcctcttctccgaccgtgggattccacgcagctatcgccacatgaacggatatggcagc
cacacctatagcctcatcaatgagaaaggcgagcgggtatggtgcaagttccacataaaa
acgatgcagggcattcaatgcctcaccgacgaggaggccgagcgaatcatcggcaaggat
cgtgagagccaccaacgcgatctttttgagaccatcgaacgcggcgagtttccgcgctgg
aagatgtatatccaggtcatgacagacgaacaagcgaagaacttccgctggaaccccttc
gacctcaccaaagtctggccgcatgccgagtacccgctcattgaggtcggcattctcgaa
ctgaaccgcaacccagaaaactactttgcggaggtagaacaggccgcctttagtcctagc
gccatcgtgccaggcatcagttggagcccggacaaaatgctgcaggcccgcctcatgagc
tatgcggatgcgcatcgctatcgcgtcggcaacaactaccatcaactgccggtcaaccgt
ccgcgctgcccggtaaaaaactaccagcgtgacggatttatgacgcacggagagtacggt
gctgcgccaaactacttccccaattcacgcgagggcacaccgcaacccgcgcccgagtat
aaggaaccagcctggtaccttggtgacgtgacggtagatcggtacgactccactaaagac
cacgacgactacacacagcccggcaacctctaccgccttttcgacgagggacaacgtgag
cgacttactacggccattgccaaagcgctgggccaagcccgcaaagaggtgcagctgcgc
cagctcgctcacttcttccgcgcggatgaagattatggacgccgggtagcccaaaagcta
ggcattgatccttccgaaatccctggccttgtaagcgccactaccgctcgctaa

DBGET integrated database retrieval system