KEGG   Chthonomonas calidirosea: CCALI_02225Help
Entry
CCALI_02225       CDS       T02699                                 

Definition
Glycosidases
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
ccz  Chthonomonas calidirosea
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccz00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CCALI_02225
Enzymes [BR:ccz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     CCALI_02225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2623562..2627098)
Genome map
AA seq 1178 aa AA seqDB search
MPRSQQPKARGLLVLSTTLALLLFALSITNAAIVQWVGNTALFLTGVPGGLPTQGAFVEP
TQTVTVVTQTYPIAFGQSVYAEVTTDNFAHVTAYPFSFDYNDSSNTHWFLVLPQFPPNTN
VQFYIKAVGTDGSVAYDNNNFQNFGFYVRHMPPPLSSPILEWFDTPYNIILQRLPEVVNA
GYGALWLPPGEKAGGGGLSVGYNPFDRFDFGDRFQSGSLDTNYGTAQDLFQLIQLAHRLG
LSVYEDTVLNHNDNRASTPINQYPDMIPEDFHIFSSSNTNNNGVDFNNTPPFAHQTLDFD
LLGMADIAQEDGNDAETGPFNLPSYATFNAYGKPTFVRQPLDPFLYPNRQPVAEDVRQYL
KRWGWWLTTFFGFDGFRLDAVRYIPPAFFQPISNYQPGPIVSGQGWLSYLYGLNPNLYVF
GEDFPNVNPNYELREYGKVGMNLLDFPLKDNLDSVFNSSGLGNIGATLGNTLGTDSATGL
AFSFGGLEPSLGVSFVQSADQGPPAASNQAYTFTLTGPERPVVYYDGNNQKPNDYTDFPR
AGRFDAVGTGDNLLLTLLDAHDRYARGNMVIRYSSSNLLIYERQVNGQSLLLAGINIRDD
GVALTQTVQTAFPAGAILTDLTGQEPPVTVQSNGSVTITIPANGTTGYANGTGYVLYVQQ
APQPLPNTPPIQLLDAETSPEQTIGFQTHLDPTGQYAQGQNLTYSFATVSTDLMDVKVTT
DAMGNSAVLQLDNGLPVAGQKPLSNTPEGLADGYVPMTKLQNGQFVLRGIDLTLLSNGLH
VIRVRVFANTGNRPGVFNQFTAFFVLNRPIFGPPPTGNLSNYPPALVYQTQTPTSNSNRL
DGLFVKNDDHNLYIGLAGSVDPSENFTNGVALYLDTHTGLGVNNLATLHDDTGPAGRLLS
NAPITLPPGFKANFGVGVLRLNNLFSSPEAPFASQPTRPTPVGAAAGLYYIDVFHANQLV
PMPSEIAWQPRPGPFSNPVTGLEVAIPLTVLFPKGMTTTTTIGMVACLRTTGESGTIFLS
TDARRGTLGSRPTPVPYLTNQFLPPLPGNNVPDPGTSSVTLQNAVTYTFQFAQTVASSSY
TLALSAPTFDSNRKLYIQNGTLTALTNLNGPVHLLVKLPQGVSLQNATGYSMLQFGTPTL
LISENDVPQGTKLSFVLRYRASQPVTPQITVKSGQGAL
NT seq 3537 nt NT seq  +upstreamnt  +downstreamnt
atgcctagatctcaacaacctaaagcgcgaggcctgctcgttcttagtacaacactggca
ctcctgctcttcgccctctccatcaccaatgctgccatcgtgcagtgggtcggcaacact
gcactttttctcaccggcgttccaggcggtcttcctacacagggtgcctttgtagagccc
acacaaaccgttaccgtcgttacccaaacctatcccatcgcttttggtcaaagcgtctat
gcggaggttacaaccgacaacttcgctcatgttacagcctacccgttctccttcgactac
aacgacagcagtaatacccactggttccttgtgctgcctcaattcccacctaacaccaat
gtgcaattctatattaaggccgttggcaccgacggctccgtggcctacgacaacaacaac
ttccaaaacttcggcttctacgtgcgccacatgccgcccccgctgtcctcacctatcctg
gagtggttcgatacgccctataacatcattttgcaacgcctacccgaggtcgttaacgca
ggctatggcgccctgtggctgccgcccggtgaaaaagctggtggaggtggactttcggtt
ggctataaccccttcgaccgtttcgacttcggcgatcggtttcagtccggctcgctcgat
acgaactatggaaccgcacaagacctctttcaactcatccagctagcccatcgccttggc
ctcagcgtctatgaagacaccgtgctcaaccataacgataatcgcgcctccacccccatt
aaccagtaccccgatatgatcccagaggacttccatatcttctcctcctcaaataccaac
aacaacggggttgatttcaacaatacgccgccgttcgcccatcaaaccctcgatttcgac
cttctcggcatggccgatatcgcgcaagaggatggcaacgacgcggaaaccggccccttt
aatctgccctcctatgccaccttcaacgcctatggtaaaccgaccttcgttcggcaacct
ctcgaccccttcctctaccctaacaggcagccggtggcggaagatgtgcgacagtacctc
aagcgatgggggtggtggctcacaaccttcttcggtttcgacggcttccgcctcgatgct
gttcgctacattccacccgccttcttccaacccatctctaactaccagcccggccccatc
gtctccggtcagggctggctctcctatctgtatgggcttaaccccaatctctacgttttt
ggcgaggacttcccaaatgtcaaccccaactacgagctacgagagtatggcaaggttgga
atgaacctgttggacttcccgcttaaagacaatctcgatagtgtgtttaactccagtggt
ttagggaacataggtgccactcttggcaacacacttggcaccgatagcgctaccggcctc
gctttctctttcggaggactagagccaagccttggtgtcagcttcgtgcaaagcgccgat
caaggccctccagctgccagtaatcaggcctataccttcacgctcaccgggccagaacga
cccgttgtctattacgacggcaataaccaaaagcctaacgactataccgacttcccgcgc
gccggccgattcgacgctgtaggcacaggcgacaaccttcttctaaccctcctcgatgcg
catgaccgttatgcgcggggtaatatggtgatccgctatagcagctctaaccttcttatc
tatgagcgtcaggtcaatggacagtcgctgctgcttgccggcattaacatccgcgatgat
ggggttgcgcttacccaaacggtgcagaccgcctttcctgccggggctatcctcaccgat
ctcaccggccaagagcctccggtaaccgttcagtccaacggcagcgtcaccatcaccatc
cctgccaacggcactacaggttacgctaatggcaccggctatgttctctacgttcaacaa
gccccacaaccattgccaaacacaccccccattcaactgttggacgccgaaacctcgcct
gaacagaccatcggctttcagacccatcttgaccccaccgggcagtatgctcaaggacag
aatctcacctactcctttgccacggtcagcaccgacctcatggatgtgaaggttaccacc
gatgccatgggcaactctgccgtgctccagctcgacaacggcctaccggtggcgggacag
aagccgctttccaacacgccggagggattggcggatggctatgtgcccatgacaaaactg
cagaacggacagtttgtgttgcgtgggatcgatctcaccctcctgtccaacggtctgcat
gtgatccgagttcgggtttttgccaatacaggcaatcggcctggcgtcttcaaccagttt
acggcctttttcgtgctcaacaggcctatctttggccctcctcccaccggaaacctctcg
aactatccgccggcgctggtctatcaaacccaaacacccacctcgaactccaaccgactt
gatggtctttttgttaagaacgacgatcacaatctctatattggcttggcaggtagcgta
gatccatcagagaacttcaccaacggtgtggcgctctaccttgatacccacacagggcta
ggcgtcaacaaccttgctacacttcatgacgatacaggccccgctggtcgcctgctctcc
aacgcccctatcacgctgcctcctggcttcaaagcgaattttggcgtgggggtgttacgt
ctcaacaatctcttctcttccccagaggcgccttttgccagtcagcctacacgcccaaca
ccggtaggcgctgcagcaggcctctactacattgacgtgttccatgcgaatcagctcgtt
cctatgccttccgagatcgcttggcagccgcgccccggccccttctccaatcctgtaaca
ggcctcgaggtggccattccgcttaccgtgctctttccaaaaggaatgaccactaccacc
actatcggcatggtcgcgtgcctgcgaacgacgggggaatcgggcaccatcttcttgtct
accgatgcccgtcgaggcactctaggcagtcggcctacgccggttccctacttaaccaat
cagttccttccaccgctgccgggcaacaacgtgcccgacccaggcacgtcaagcgttacc
ctccaaaacgcggttacctataccttccagtttgctcaaacggtggcctcttccagttac
acccttgccctctcagcgccgaccttcgattcaaaccgcaaactctatattcaaaatgga
acgcttacggcgctaaccaacctcaacggaccagtccatctcctggttaagctgcctcag
ggggtctcccttcagaatgcgacgggctatagcatgctccaattcggcacgcccaccttg
ctgatatccgaaaacgatgttccgcaaggaacaaaactttcgttcgtgttgcgttaccgt
gcctcgcaacccgtcaccccacagatcaccgtaaaaagcgggcaaggcgctctttaa

DBGET integrated database retrieval system