KEGG   Corynebacterium diphtheriae HC04: CDHC04_0313Help
Entry
CDHC04_0313       CDS       T01696                                 

Gene name
hemD
Definition
uroporphyrin-III C-methyltransferase / uroporphyrinogen-III synthase
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
cda  Corynebacterium diphtheriae HC04
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cda00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CDHC04_0313 (hemD)
Enzymes [BR:cda01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     CDHC04_0313 (hemD)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     CDHC04_0313 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
322854..324524
Genome map
AA seq 556 aa AA seqDB search
MRLIMKPEHSTRGRVIFVGAGPGNPDLLTVRAREVLGSTANAVVDSTVGVGIRAVIAEHL
EVPQAKLDAAEAEYERMCAAAKRRKPPRPDAPTAAEITEVSADASVDEVMAVLLPLLDEG
DVIRLVQGNPLADSRALDEITAVTQVGADFQIVPGMSLPAAVPAFAGITLGDSYTKTTVS
EDTNWDQLATAPLPLILQASKDDLLTIATELKDRKLPASTPVTVTMNGTTRLQRSFDVTL
KTMKSLVKQELDGTLVVTVGVSDRSTFSWWESRALFGWRVLVPRAKDQAGPMSSRIAAYG
AIAQEVPTISVEPPRNPAQLERAIKGIVEGRYQWVVFTSVNAVKAVREKIVSFGLDSRAF
AGVHIAAVGAKTAAAIREFGITPELIPPRKEHNAAGMVSVFPNYVEGLDPVGRVLLPRAD
IATDVLVDGLVNLGWEVDDVVAYRTVRAAPPSAEVRDMIKSGDFDAVCFTSASTVRNLVG
IAGKPHARTIIACIGPMTAAEAEKQGLRVDVIPEVANVPALVDALAEHVEKLRAAGELPP
PRKKRRARRKSKEGAV
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgcgattaatcatgaagcccgagcactcaacgcgaggacgtgtcatcttcgtcggcgcc
ggtcccggcaacccagatcttttgacggttcgagcccgcgaggtgctgggctccacagcc
aatgcagtggtggattccactgttggcgtaggtattcgcgcagttattgctgaacatctt
gaggtgccgcaggccaagcttgatgcagctgaggctgagtatgagcgcatgtgtgcggct
gcgaagcgtcgtaagcctccgcgtcccgacgcccccaccgccgcggaaatcactgaggtg
tccgctgatgcgagcgtcgatgaagtgatggcggtgctgttgcctttgctagacgaaggc
gatgtgatccgcctagtgcagggtaacccgttggcggattcccgcgcgttagatgagatt
acggctgttacacaggtgggcgcggatttccagattgtgccaggtatgtcgttgccggct
gcggttcctgctttcgcgggtattacgttgggtgattcttataccaagaccacggtgagt
gaggatactaactgggatcagttggcaaccgccccgctgccgttgattttgcaggcgagt
aaagacgacttgctgactatcgctacggagttgaaggatcgcaaactgccggcgagcact
ccggtgacggtgacgatgaatggcacgacgcgtttgcagcgtagctttgacgtgacgctt
aaaactatgaagtcgctggtcaaacaggagctcgatggcacccttgtggtcacagtgggt
gtatcggatcgcagtacattttcgtggtgggaaagccgcgcgttgtttggctggcgggtg
ttggttccccgtgcgaaggatcaagctggtccgatgagcagccgaatcgccgcttatggt
gctattgcccaagaggttcccactatttctgtggagccgccgcgtaatccggcgcagttg
gagcgtgcgattaagggcattgtggagggacgctaccagtgggtggtgtttaccagcgtg
aatgctgttaaagcggtgcgtgagaagatcgtgtcgtttggtttggattctcgcgcgttc
gcgggggtgcatatcgctgcggtgggggctaagactgcggcggcgattcgtgagtttggc
attactcctgagctaattccgccacgtaaggagcataatgctgcgggtatggtgtcggtt
ttccctaattatgtggagggcttggaccccgtaggtcgagtgttgctgccgcgggctgat
attgccactgacgtgctggttgatggtttggtcaaccttggctgggaagttgatgatgtg
gtggcgtatcgtacggtgcgtgccgcgccgccgagtgcggaagtccgcgacatgattaag
tctggcgattttgatgcggtgtgttttacctctgcgtcgacggtgcgcaatttggtgggt
attgcgggtaagccgcatgcgcgcacgatcattgcatgtattgggccgatgaccgccgcg
gaggcagagaagcaagggctgcgtgtcgacgtcatccccgaggtggctaacgttccggct
cttgtggatgcgctcgcggagcatgtggagaaactgcgtgctgcgggtgagttgccgccg
ccgcgtaagaagcgtcgggcccgtcgcaaatctaaggaaggtgctgtatga

DBGET integrated database retrieval system