KEGG   Corynebacterium diphtheriae HC04: CDHC04_0421Help
Entry
CDHC04_0421       CDS       T01696                                 

Definition
(GenBank) putative regulatory protein sugar kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
cda  Corynebacterium diphtheriae HC04
Pathway
cda00010  Glycolysis / Gluconeogenesis
cda00052  Galactose metabolism
cda00500  Starch and sucrose metabolism
cda00520  Amino sugar and nucleotide sugar metabolism
cda00521  Streptomycin biosynthesis
cda01100  Metabolic pathways
cda01110  Biosynthesis of secondary metabolites
cda01120  Microbial metabolism in diverse environments
cda01130  Biosynthesis of antibiotics
cda01200  Carbon metabolism
Module
cda_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cda00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CDHC04_0421
   00052 Galactose metabolism
    CDHC04_0421
   00500 Starch and sucrose metabolism
    CDHC04_0421
   00520 Amino sugar and nucleotide sugar metabolism
    CDHC04_0421
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CDHC04_0421
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    CDHC04_0421
Enzymes [BR:cda01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     CDHC04_0421
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: AEX80414
Position
434254..435138
Genome map
AA seq 294 aa AA seqDB search
MTHALGVDIGGTKIAVGIVDSTDPTTVISRHIVPTPDHDVIDRVRDAIAHIITPEVTSIG
IGAPGVIDETTGVVVSSGPTMQGWAGTRIADTIAAEFSLPVAVHNDVRVMGLGESIYGAG
RDYTNVLFVSLGTGVGGAIVRDGRLVASPHHTAGELRALIGRLPDGRADLLENFAAGPGL
AQRFGERYPEHAGRDLRFIMDLYHAGDTHARDYITATLAAAGETIAGFASAIDVDAIIIG
GGVGNIGDAIIKPFAHGFAAHAIPPLGTIPIRQAQLGTDAPIVGAAHLGHSAIE
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgacacacgcactcggtgtcgacatcggcggcactaaaatcgcagtcggaatcgtagac
agcacggaccccaccaccgtaatcagccgacacatcgtccccacacccgaccacgacgtg
attgaccgcgtacgcgacgcgatcgcccacatcatcaccccagaagtaaccagcattggc
atcggcgcgccgggcgtgatcgacgaaaccacaggagtagttgtctcctccggtcccacc
atgcaaggctgggctggcacacgcattgcggatactatcgccgcggaattttcgctaccc
gtcgccgtgcataacgacgtccgcgtcatggggctcggcgaatccatctacggcgccgga
cgcgactacaccaatgtgctctttgtcagccttgggacaggtgtcggcggagccattgtt
cgtgacggacgcctcgtagcatccccgcaccacactgcaggcgaacttcgggcactcatc
ggcaggcttcccgacggccgcgcagacctcctagaaaacttcgccgcaggacccggcttg
gcacaaagattcggtgaacgctaccccgaacacgcaggccgtgacctgcgattcatcatg
gacctctaccatgcaggagacacccacgcccgcgactacatcaccgcaacacttgcagca
gctggcgaaaccatcgcaggattcgccagcgccatcgacgtagacgccatcatcatcggc
ggcggagtaggcaacatcggcgacgccatcatcaaaccatttgcccacggattcgcagcc
cacgccattccaccgctgggcacgatccccatccggcaagcacaacttggcaccgacgca
ccgatcgtcggcgcagcacaccttggccacagcgccatcgaataa

DBGET integrated database retrieval system