KEGG   Corynebacterium diphtheriae HC04: CDHC04_0717Help
Entry
CDHC04_0717       CDS       T01696                                 

Gene name
echA2
Definition
enoyl-CoA hydratase
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
cda  Corynebacterium diphtheriae HC04
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Phenylalanine metabolism
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:cda00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    CDHC04_0717 (echA2)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    CDHC04_0717 (echA2)
   00650 Butanoate metabolism
    CDHC04_0717 (echA2)
  Lipid metabolism
   00071 Fatty acid degradation
    CDHC04_0717 (echA2)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CDHC04_0717 (echA2)
   00310 Lysine degradation
    CDHC04_0717 (echA2)
   00360 Phenylalanine metabolism
    CDHC04_0717 (echA2)
   00380 Tryptophan metabolism
    CDHC04_0717 (echA2)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CDHC04_0717 (echA2)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CDHC04_0717 (echA2)
   00281 Geraniol degradation
    CDHC04_0717 (echA2)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CDHC04_0717 (echA2)
   00627 Aminobenzoate degradation
    CDHC04_0717 (echA2)
   00930 Caprolactam degradation
    CDHC04_0717 (echA2)
Enzymes [BR:cda01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CDHC04_0717 (echA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
740794..741570
Genome map
AA seq 258 aa AA seqDB search
MAQVEVRIDGHLMCVTVNRHEVRNALSAQMCDDITSALNNADEQARDTAAIRAVLIRSVG
TTFCAGADLGSTTQSDDAAEVTQSDFHDSLTRMLESVVSCGVPVIADIQGPAVGAGMQLA
LSCDLRLVHHAAWFKVPAASLGFALDGWTINRAQCLLGGGWARSIFLGGATLSAPQAVAT
GFALEIADSDSAIAYAHRVAGMAPLALRQLKSALNSADFEYALVGESRDLFAQCWASTDA
REGQLARKQKRDPVFTGR
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
gtggcgcaggtagaggtgcgtatcgacggccacctgatgtgtgtcaccgtaaatagacac
gaggttcgcaacgcactttctgcacagatgtgcgatgatattacatctgctcttaataat
gcagatgagcaggcgcgtgacactgcagctattcgcgccgtgctcatccgttctgttggt
acgaccttttgtgccggagcagatttgggcagtaccacccaaagtgatgatgcggctgag
gtaacgcagtcggatttccatgactctcttacgcgcatgttggaatcggttgtttcctgt
ggagtcccagttattgctgatattcaaggaccagctgttggcgctggcatgcagctggca
ttgagctgcgacctgcgtttggttcatcatgctgcatggtttaaggtgccggcggcgtct
cttgggttcgcgctcgacggatggactattaatagggcacagtgtttgctgggcggcggt
tgggcgcgatcaattttcctgggcggcgcaacgctatcggcaccgcaggcggtggcaact
ggttttgcgctggagatcgctgattccgattctgcgattgcctatgctcatcgtgttgct
ggaatggcccccttggcgctgcggcaacttaaatccgcgctcaacagtgctgattttgaa
tatgcgcttgttggggaatctcgtgatctttttgcccaatgttgggctagtacggatgct
cgcgaagggcagctggctcgaaaacaaaagcgagatccggtatttactggtcgctga

DBGET integrated database retrieval system