KEGG   Corynebacterium diphtheriae HC04: CDHC04_0896Help
Entry
CDHC04_0896       CDS       T01696                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
cda  Corynebacterium diphtheriae HC04
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cda01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:cda00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
926440..927537
Genome map
AA seq 365 aa AA seqDB search
MLDLTTNPIDLTRALVDIESPSHYEKNIADAIEQALHAIDNVEVLRHGNTLVARTHRGLG
ERVILAGHIDTVPIADNVPSHMEGDVMFGCGTVDMKSGMAVYLHAFATLANHPALAKDLT
VVCYEGEEVASEYNGLGHVQAAHPDWLSGDLALLGEPSGAVIEAGCQGTIRLRVTAHGVR
AHSARSWLGDNAMHKLAPVITNIAQYHAQEVLVDGCLYHEGLNIVHCESGVATNTIPDEA
WMFVNFRFAPNRSVDEALAHMLEVLDLPEGVTYDIDDAVPGARPGLDRPAAAALLEATGG
KFRAKYGWTDVSRFSEIGVPAVNFGPGDPAYCHKKDEQCPVSMITEVSRTLVHYLTSTNS
QTTGA
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgctcgatttgactacgaatcccattgacctcacccgcgcacttgttgatatagaaagc
ccctcccattacgaaaagaacatagccgacgccatcgagcaggctcttcatgccatcgac
aatgttgaagtgctacgccacggcaatactcttgttgctcggacccatcgaggactagga
gaaagagtaatcctcgccggccacattgacaccgtcccaatagccgacaacgttcctagc
cacatggaaggcgacgtaatgttcggctgcggcaccgtcgatatgaaatcgggcatggct
gtctatcttcatgcctttgccaccttggctaaccacccagcgctggcgaaggacttgacc
gtcgtctgttatgagggcgaggaagtcgctagtgaatacaacgggctggggcatgtgcag
gcagctcaccccgactggttaagtggcgatctcgccctcctaggcgagccttccggtgct
gtgatcgaagctggatgccaaggaacgattcgtttgcgcgtcaccgcccatggtgtgcgc
gcacactcggcacggtcgtggctaggagacaacgccatgcacaaattagcgccagttatt
acgaatatcgcacagtaccacgcccaagaagtgcttgtcgacggctgcctctatcacgag
ggcctcaacatcgtgcattgcgaatctggggttgccacgaacactatccccgatgaggcc
tggatgtttgttaacttccgtttcgcacctaataggagtgttgacgaagccctagcccac
atgctggaggtgttggatctacccgagggggtgacctatgacatcgacgatgctgttcca
ggggcacgtccgggtttggatcgtccggcagctgccgccctcctagaggcgacaggcgga
aaattccgcgcaaagtacggttggacggatgtgtcgaggttttctgagattggtgttcca
gcggtgaactttggtcctggggatccggcatattgccataaaaaagacgaacaatgccca
gtcagcatgattaccgaagtctctcgcacgctggtgcactatctcacgagtacgaattcc
cagacgacaggagcctga

DBGET integrated database retrieval system