KEGG   Corynebacterium diphtheriae HC04: CDHC04_0898Help
Entry
CDHC04_0898       CDS       T01696                                 

Gene name
folP
Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
cda  Corynebacterium diphtheriae HC04
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cda00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
928302..929159
Genome map
AA seq 285 aa AA seqDB search
MTRSAFQHDPECATVMAIVNRTPDSFYDHGATHALADAITRASAVIAQGAGIVDIGGVKA
GPGPYVSPSEEIERVVPVIDAVHRAHPEITISVDTWRAEVADVAIRAGASLVNDTWAGHD
PELAEVAGHYRVGYVCSHTGGVAPRTRPHRVRFDDIVASVIEETTAQAERAVRLGVPEDR
ILIDPTHDFGKNTFHGLELLRRIDEIVATGWPVLMALSNKDFVGETLARSVDQRVAGTLA
ATAWAAAHGVAAFRSHQVAETVDVIRMTAAIQGRVPPLATTRGLV
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgactaggagtgcgtttcaacacgatcccgagtgcgcaacggtcatggcgatcgttaat
cgcaccccagattccttttacgaccacggtgcgacccatgcgttagcagatgccataaca
cgcgccagtgctgtgattgcgcagggggcggggatcgtcgatattggtggggtcaaggca
ggtcctggcccttatgtctctcctagtgaggagattgaacgggtggtaccagttatcgac
gcagttcaccgtgcgcaccccgagatcaccatttcggtagatacgtggcgtgccgaggtc
gctgatgtggcgatccgcgccggggcgtcgttagtaaacgacacgtgggccggccatgat
ccggagcttgccgaggtagcgggacattatcgcgtgggatacgtgtgttctcatacggga
ggcgtagcgccacgcacccgcccgcaccgcgtgcgtttcgacgacatcgttgcctctgtt
attgaggaaacaacagctcaagctgagcgggcggttcgccttggtgttcctgaggaccgc
attcttatcgaccccacccatgattttggcaaaaacacctttcatggactggagctgctg
cggcgtatcgatgagattgtggcaaccggctggccagtactgatggccttgtctaacaaa
gattttgtaggagagacgctggctcgctctgtcgaccagcgtgtagccggaacccttgca
gctacagcgtgggcagcggctcatggagttgcggcttttcgttcgcaccaagtcgcagaa
accgtcgatgtgatccgcatgaccgccgcaatccaaggacgcgtgccacctctggctacc
acacgggggcttgtatga

DBGET integrated database retrieval system