KEGG   Corynebacterium diphtheriae HC04: CDHC04_1327Help
Entry
CDHC04_1327       CDS       T01696                                 

Gene name
ppgK
Definition
(GenBank) polyphosphate glucokinase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
cda  Corynebacterium diphtheriae HC04
Pathway
cda00010  Glycolysis / Gluconeogenesis
cda00520  Amino sugar and nucleotide sugar metabolism
cda01100  Metabolic pathways
cda01110  Biosynthesis of secondary metabolites
cda01120  Microbial metabolism in diverse environments
cda01130  Biosynthesis of antibiotics
cda01200  Carbon metabolism
Module
cda_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cda00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CDHC04_1327 (ppgK)
   00520 Amino sugar and nucleotide sugar metabolism
    CDHC04_1327 (ppgK)
Enzymes [BR:cda01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     CDHC04_1327 (ppgK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: AEX81320
Position
1405239..1406000
Genome map
AA seq 253 aa AA seqDB search
MIRMENIGFGIDVGGSGIKGARVNLDTGEFVGDRIKILTPKPATPDAVAETIKRILDQAE
WEGPVGITLPSVIHEQRALTAANIDPSWIDVDVNELFARHLGDTEVSVLNDADAAGLAEA
QFGDPIAREGSVILLTFGTGIGSAFLVNGTLFPNTELGHMLVDGEEAEKIASSAAKDRDE
IGYGKWAKRVSKVLNEYERLFWPSAFIVGGGISRKAEKWVPRLTVNTKVVPAQLRNTAGI
VGAAMAASQNLHP
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgatccgcatggaaaacatcggattcggtatcgacgttggcggctctggtatcaaggga
gcgcgcgtgaatctagacacaggagaatttgtaggagatcgtatcaagattcttactcct
aaacctgcaacccccgatgcagtcgccgaaacaatcaaacgcatcctcgatcaagccgaa
tgggaagggcctgtcggcattactctaccttccgtcattcacgaacaacgagccctcacc
gccgccaatatcgacccatcgtggattgatgtagacgtaaatgagctatttgctcggcat
ttaggcgacaccgaagtttcggttctcaatgacgccgacgctgcgggattggcagaagcc
caatttggcgatcccattgcacgtgaaggaagtgtaatccttctaacctttggtacaggt
ataggttcagcattcttagtcaacggtacgttgtttcccaacactgaactaggccacatg
cttgtagatggcgaagaagcagaaaaaatcgcatcgtctgcagccaaagatcgcgatgaa
attggatacggaaagtgggctaagcgcgtatcgaaggtgctcaacgaatatgagcggctc
ttttggccatcagcttttatcgtcggtggtggcatctcccgtaaagctgaaaagtgggta
cctcgtctcaccgttaacaccaaggttgtcccagcccagctaagaaacaccgctggaatc
gtaggagctgccatggcagcatcccaaaatcttcacccctaa

DBGET integrated database retrieval system