KEGG   Corynebacterium diphtheriae HC04: CDHC04_1470Help
Entry
CDHC04_1470       CDS       T01696                                 

Gene name
hisI
Definition
phosphoribosyl-AMP cyclohydrolase
Orthology
K01496  
phosphoribosyl-AMP cyclohydrolase [EC:3.5.4.19]
Organism
cda  Corynebacterium diphtheriae HC04
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cda01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:cda00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1566079..1566429)
Genome map
AA seq 116 aa AA seqDB search
MDDPASYELDPSIAQRVKFNSAGLVPAVVQSTDGEVLMLAWMDAHALAYTIATRKGTYFS
RSRNEYWIKGLTSGHTQQVTGLQLDCDGDTVLMTVVQQGGACHTGDRTCFDADVII
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
atggacgatccagcatcctatgagctcgatcccagcatcgcgcagcgagtcaaattcaac
agtgctgggttagtgcctgcagttgttcagtccacagatggggaagttctcatgctggct
tggatggatgctcatgcgttggcgtataccattgctacgcggaagggtacatatttttct
cgttcccgaaacgaatattggattaaaggccttacttcaggccacactcagcaggttaca
ggtctgcaattggactgtgatggcgataccgtgttgatgacagtggttcagcaaggtgga
gcctgtcacacaggtgaccgcacctgctttgacgctgacgttatcatttaa

DBGET integrated database retrieval system