KEGG   Corynebacterium diphtheriae HC04: CDHC04_1470Help
Entry
CDHC04_1470       CDS       T01696                                 

Gene name
hisI
Definition
phosphoribosyl-AMP cyclohydrolase
Orthology
K01496  
phosphoribosyl-AMP cyclohydrolase [EC:3.5.4.19]
Organism
cda  Corynebacterium diphtheriae HC04
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:cda00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CDHC04_1470 (hisI)
  Amino acid metabolism
   00340 Histidine metabolism
    CDHC04_1470 (hisI)
Enzymes [BR:cda01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.19  phosphoribosyl-AMP cyclohydrolase
     CDHC04_1470 (hisI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1566079..1566429)
Genome map
AA seq 116 aa AA seqDB search
MDDPASYELDPSIAQRVKFNSAGLVPAVVQSTDGEVLMLAWMDAHALAYTIATRKGTYFS
RSRNEYWIKGLTSGHTQQVTGLQLDCDGDTVLMTVVQQGGACHTGDRTCFDADVII
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
atggacgatccagcatcctatgagctcgatcccagcatcgcgcagcgagtcaaattcaac
agtgctgggttagtgcctgcagttgttcagtccacagatggggaagttctcatgctggct
tggatggatgctcatgcgttggcgtataccattgctacgcggaagggtacatatttttct
cgttcccgaaacgaatattggattaaaggccttacttcaggccacactcagcaggttaca
ggtctgcaattggactgtgatggcgataccgtgttgatgacagtggttcagcaaggtgga
gcctgtcacacaggtgaccgcacctgctttgacgctgacgttatcatttaa

DBGET integrated database retrieval system