KEGG   Corynebacterium diphtheriae HC04: CDHC04_1564Help
Entry
CDHC04_1564       CDS       T01696                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
cda  Corynebacterium diphtheriae HC04
Pathway
cda00260  Glycine, serine and threonine metabolism
cda00750  Vitamin B6 metabolism
cda01100  Metabolic pathways
cda01110  Biosynthesis of secondary metabolites
cda01120  Microbial metabolism in diverse environments
cda01230  Biosynthesis of amino acids
Module
cda_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cda00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CDHC04_1564 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    CDHC04_1564 (thrC)
Enzymes [BR:cda01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     CDHC04_1564 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP PLCC
Motif
Other DBs
NCBI-ProteinID: AEX81555
Position
complement(1665953..1667401)
Genome map
AA seq 482 aa AA seqDB search
MKYISTRDASSTPAHFTDILLGGLAPDGGLYLPEQYPQLTEELLEQWRTLLEDKGYAALA
AEVLKLFIDDISAADIEKITARAYTTPKFSDEDIVPVTKLENNIYIGHLSEGPTAAFKDM
AMQLLGELFEYELGRRGESLNILGATSGDTGSSAEYAMRGRKGIRVFMLTPAGRMTPFQQ
AQMFGLDDPNIFNIALDGVFDDCQDVVKAVSGDSEFKKNYRIGAVNSINWARLVAQVVYY
ISSWLRVTDSNDQKVSFCVPTGNFGDICAGHIAKQMGLPIDRLIVATNENDVLDEFFRTG
DYRVRSSADTYETSSPSMDISRASNFERFVFDLLGRDAGRVADLFGVQVKQGGFSLAQDP
AFAEAANRYGFASGKSTHADRVATIADCYENRGMMIDPHTADGVKVARDWACDIDSPIVC
LETALPVKFADTICEATGREPEMPERFANIMDAQRRVTDLPNDVSVVKDFIVTSIEETEK
TQ
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatatttcaacgcgcgacgcatcatcaacacctgctcattttaccgatatcttg
cttggtggacttgcccccgatggtggtctttacctgccagaacagtatccacaactgacc
gaagagctgcttgagcagtggcgtacgttgttagaagacaaagggtatgcggcactcgct
gctgaagtattaaagctatttatcgacgacatctccgcggccgatattgaaaaaatcacc
gcccgtgcgtacaccacgcccaagttttctgatgaagacatcgttccagtgacaaaactg
gagaacaacatttatatcggtcatctttcagaaggcccaacggcggcatttaaagacatg
gcaatgcagttgctcggcgaacttttcgaatatgagctagggcgtcgcggcgaatccctg
aatatcctcggtgcaacctccggtgacaccggatcgtctgcggaatacgccatgcgtggc
cgaaaggggatccgcgtttttatgctcacccctgcgggacgtatgaccccattccaacag
gcacagatgttcggtcttgatgacccaaatatctttaatatcgcgctcgatggtgtattc
gacgattgccaagatgtagttaaagcagtgtcgggggattcggaatttaaaaagaactac
cgaatcggagcggtgaactccattaactgggcacgtcttgtagcacaagttgtgtattac
atttcttcttggcttcgcgttaccgatagcaacgatcaaaaagtgagcttttgtgtacca
accggcaacttcggtgacatctgcgcagggcatattgcaaaacagatgggtcttcctatc
gatcgccttatcgttgcaacgaatgaaaatgatgtgctcgatgagtttttccgcaccggc
gattaccgtgtacgcagctctgcagatacgtatgaaacgtcttctccgtccatggacatt
tcgcgtgcttctaactttgaacgctttgtatttgatcttctcggacgagatgcaggcaga
gtagctgatctatttggtgtacaagtcaagcagggtggattcagcttggctcaggaccca
gcattcgccgaggccgcgaatcgttacggatttgcctccggtaaatctacccatgctgat
cgcgttgccacgattgcagactgctacgaaaatcgtggcatgatgatcgaccctcatacc
gcggacggtgtgaaagtagcacgagattgggcctgcgatattgattcgccaattgtctgc
cttgaaactgcgcttccagttaagttcgctgacactatctgcgaagcaacaggacgcgaa
cctgagatgccagagcgctttgccaacatcatggatgctcaacgtcgtgtaactgatctt
cctaatgacgtatcagtggtcaaagacttcattgtgactagcatcgaggaaaccgaaaaa
actcagtag

DBGET integrated database retrieval system