KEGG   Corynebacterium diphtheriae HC04: CDHC04_1721Help
Entry
CDHC04_1721       CDS       T01696                                 

Definition
hypothetical protein
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
cda  Corynebacterium diphtheriae HC04
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:cda00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1837323..1837772
Genome map
AA seq 149 aa AA seqDB search
MNALLIIDIHANSPAPEATEITHAIALHLGQHRGDYSHVIAALQGTIADELAGTTFSNQF
IKDPATQALSAFERTDATGTKLGDWLRANNIDRLDVVGLGTELGIRSSVLDALAQGFDVH
VHKKLCAAVSHDNARAAYNEMDMCGALFE
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcacttcttattatcgatatccacgccaactcccctgcccccgaggccaccgag
atcacccacgccatcgccctacatctcggccagcaccgcggcgactactcccacgtcatc
gccgctctccaaggcactatcgccgatgaactagccggtactacctttagtaatcaattc
attaaagaccccgccacccaggccttatccgcttttgagcgcacagatgccaccggcacc
aaactcggcgactggctccgtgccaacaacatagatcgcctcgacgttgtaggccttggc
accgaactcggcattcgctccagcgtgttagacgcactcgcccaaggatttgatgtgcac
gtgcacaaaaaactctgcgctgccgtatcacacgacaacgcccgcgctgcctataacgaa
atggacatgtgcggggcgttattcgaataa

DBGET integrated database retrieval system