KEGG   Corynebacterium diphtheriae HC04: CDHC04_1870Help
Entry
CDHC04_1870       CDS       T01696                                 

Gene name
folK1
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
cda  Corynebacterium diphtheriae HC04
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cda00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CDHC04_1870 (folK1)
Enzymes [BR:cda01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     CDHC04_1870 (folK1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1994344..1994823)
Genome map
AA seq 159 aa AA seqDB search
MRAVLSIGSNMDDRYALLRTVVEEFAGEIVAASSIYSTPPWGVEDQDEFLNAVVIVDVDS
SPLELLRRGQRLEEAACRRRLRHWGPRTLDVDVVTIYNDDGTPMVSSDPELTLPHPYAHE
RAFVLVPWAEADPEAELLGQKVAQRAAALGETFPVVGSL
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcagtgctttctattggttcgaatatggatgaccgctatgccttgctgcgaacg
gttgtcgaagaattcgcgggagagatcgtggcagcatcctcgatctattccacgcccccg
tggggagtagaggaccaagacgagttcctcaacgcagtcgtcattgtggacgtcgatagt
tcaccccttgagctgctacgacgtggccagcgcctagaagaagccgcgtgtcgacgtcgc
ctgcggcactggggtccgcgcaccctagacgtcgacgtcgtgaccatctacaacgacgac
ggcacccccatggtatccagcgaccccgagctgactctgccgcacccctacgcccacgag
cgagcctttgtgcttgtgccttgggcagaagcagaccccgaagctgaattgctaggccag
aaagtagcgcagcgcgccgcagcactgggcgaaacatttccggtggtgggaagcctatga

DBGET integrated database retrieval system