KEGG   Corynebacterium diphtheriae HC04: CDHC04_1910Help
Entry
CDHC04_1910       CDS       T01696                                 

Gene name
folK2
Definition
putative 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
cda  Corynebacterium diphtheriae HC04
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cda00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2041362..2041841)
Genome map
AA seq 159 aa AA seqDB search
MRAVLSIGSNMDDRYALLRTVVEEFAGEIVAASSIYSTPPWGVEDQDEFLNAVVIVDVDS
SPLELLRRGQRLEEAACRRRLRHWGPRTLDVDVVTIYNDDGTPMVSSDPELTLPHPYAHE
RAFVLVPWAEADPEAELLGQKVAQRAAALGETFPVVGSL
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcagtgctttctattggttcgaatatggatgaccgctatgccttgctgcgaacg
gttgtcgaagaattcgcgggagagatcgtggcagcatcctcgatctattccacgcccccg
tggggagtagaggaccaagacgagttcctcaacgcagtcgtcattgtggacgtcgatagt
tcaccccttgagctgctacgacgtggccagcgcctagaagaagccgcgtgtcgacgtcgc
ctgcggcactggggtccgcgcaccctagacgtcgacgtcgtgaccatctacaacgacgac
ggcacccccatggtatccagcgaccccgagctgactctgccgcacccctacgcccacgag
cgagcctttgtgcttgtgccttgggcagaagcagaccccgaagctgaattgctaggccag
aaagtagcgcagcgcgccgcagcactgggcgaaacatttccggtggtgggaagcctatga

DBGET integrated database retrieval system