KEGG   Corynebacterium diphtheriae HC04: CDHC04_2144Help
Entry
CDHC04_2144       CDS       T01696                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
cda  Corynebacterium diphtheriae HC04
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:cda00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2326176..2327696)
Genome map
AA seq 506 aa AA seqDB search
MNQPQYVAAIDQGTTSTRCIIFDHNGQQVGVGQYEHEQIFPQKGWVEHNPMEIWANTRQA
VGTALAESDVSREDIVAVGITNQRETTVVWNKTTGEPIYNAIVWQDTRTNSICSELAQGD
PARWQKRTGLLINSYPAGPRLKWILDNVEGARELAENGDLLFGTIDTWLLWNLTGGAEGD
NGQPAVHATDVTNASRTLLMDLESLQWDEELCAALDIPMQVLPEIRPSVGNFGQVRARGS
LAGVPIRAILGDQQAAMFGQACFRPGDAKCTYGTGLFLLENTGKTPKHSENGLLTTVCFQ
LEGEKPVYALEGSVAMGGSLVQWLRDNLQIIPNSPAIENLAREVPDNGGVYIVPAFSGLF
APRWRPDARGVIVGLTRFANRKHLARAVLEATAYQVREVIDAMVADSGVELTEMRVDGGM
VMNELLMQFQADVLRSDVTRPKNIETTATGVAYAAGLGVGYWDSLDVLRSMNEVDKTWHA
KMDADKIDELLAEWNKAVERTYNWEN
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaaccacagtatgttgctgcgattgaccaaggaacgacgtcgacacgctgcatt
attttcgaccacaacggccaacaagtaggcgttggccagtacgaacacgaacaaatcttc
ccccaaaaaggctgggtagagcacaacccaatggaaatctgggccaacacgcgccaagcc
gttgggacagcactcgccgaaagcgacgtctcccgtgaagacatcgtggccgtaggcata
acaaaccagcgtgaaaccacggtggtctggaacaaaactactggtgagcccatatataac
gccattgtgtggcaggacacccgcactaactccatctgctcggagttagcccaaggcgac
cctgcccgatggcagaaacgtaccggtttgctcatcaactcataccccgcgggtccccga
ctcaagtggatattggacaacgtcgagggtgcccgcgaactagcagagaacggcgatttg
ctcttcggaaccattgatacgtggttgctgtggaacctgaccggcggtgccgagggcgac
aacggccagcctgccgttcacgctaccgacgtaaccaatgcctcccgcaccctactcatg
gatctggaatccctgcaatgggatgaggaactatgtgccgcgttggatattccaatgcag
gtgttgccagagattcgtccttcagttggtaacttcggccaagtacgtgcacgtggatca
ctagctggtgttccgatccgcgccatcctcggtgaccagcaagccgcaatgttcggacag
gcatgcttccggccaggtgacgccaaatgtacatacggcacggggctgttccttctagag
aacacaggcaaaaccccgaagcattccgaaaacggtttgctcaccaccgtctgtttccaa
ctcgaaggcgaaaaaccggtctatgccctcgaaggatccgtcgccatggggggctcgctc
gtccaatggctacgcgacaacctccaaatcatcccgaactcgcccgccatcgaaaacctc
gcccgcgaagtacccgacaacggtggcgtctacatcgtccccgcattctccggactattc
gcaccacgctggcgccccgacgcccgcggggtcatcgtgggcctgacccgctttgccaac
cgcaagcacctcgcccgcgcagtgctcgaggccaccgcctaccaagtgcgcgaagtgatc
gatgccatggtcgcggattccggagtagaactcaccgaaatgcgtgtcgacggtggcatg
gtcatgaacgagctgctcatgcaattccaagccgacgtcctacgatccgacgtcacccgc
cccaagaacatcgaaaccacagccaccggcgtagcctacgcagcaggcctcggcgtaggc
tactgggacagcctcgacgtactccgcagcatgaacgaagtggacaaaacctggcacgcc
aagatggacgccgacaagatcgacgaactccttgccgaatggaacaaagcagtcgaacgc
acctacaactgggaaaactaa

DBGET integrated database retrieval system