KEGG   Corynebacterium diphtheriae HC04: CDHC04_2250Help
Entry
CDHC04_2250       CDS       T01696                                 

Gene name
trpB1
Definition
(RefSeq) tryptophan synthase subunit beta
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cda  Corynebacterium diphtheriae HC04
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cda00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CDHC04_2250 (trpB1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CDHC04_2250 (trpB1)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CDHC04_2250 (trpB1)
Enzymes [BR:cda01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CDHC04_2250 (trpB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
2452413..2453744
Genome map
AA seq 443 aa AA seqDB search
MTDSTLRKTLISAYFGNYGGQFVPDALLPVLDELEQAYVDALNDPEFSRELARLQKHYLG
RPTPITECANLPLAGKGKGKARIFLKREDLVHGGAHKGNQVLAQALIARRLGKTRLIAET
GAGQHGTATAMVAALMGMDCTIYMGAKDVARQQPNVYRMRLMGATVVPVTNEHGDSMSDA
IDVALMDWVENLDTTHYLIGSAVGPHPFPTLVKEFQAVISRESREQMLELTGKLPDAVVA
AVGGGSNAIGAFADYLTDKPGNESVRLIGVEPAGEGLDSGKHGAPLQRGKVGVQHGFKSF
ILADEQGNPLHSYSVSAGLDYPGVGPEHAHLMESGRAQYYGITDAEALQAFRMLSRYEGI
IPALESSHALAYALKMAENTEETDTPINIVVNLSGRGDKDVDYVRNILGDLATEDPATSP
VTDPHVAETLAAMIAESNAREGV
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgactgactccaccctccgtaagacgttaatcagcgcctactttggtaactacggcgga
cagtttgttcccgatgcgctcctgccggttctcgacgaactagagcaggcctatgtggat
gcactcaacgacccagagttttcgcgggaacttgctcggctacaaaagcactaccttggt
cgtcccactcctattaccgaatgcgctaacctccccctagcgggtaaggggaagggtaag
gcgcggatcttcctcaaacgcgaggatctagttcacggtggcgcgcataagggcaatcag
gtgcttgcccaggcgttgattgctcgcagattgggtaaaactcgtttgatcgcagaaacc
ggtgctggtcagcacggtaccgccactgcgatggtggcggctttgatgggaatggactgc
accatttatatgggtgctaaagatgtggcccgccagcagcccaatgtgtatcgcatgcgg
ctcatgggggctacggtggtaccagttaccaacgagcatggtgattctatgtcggatgct
atcgacgtagcgcttatggactgggtggaaaacctagataccacgcactacctgattggt
tctgcggtcggtccacatccgttccctacgctggtcaaggagtttcaggcggttatttcg
cgggaatctcgcgaacagatgctggagctaacaggcaagcttccggacgcggtggttgct
gctgtaggcggtggttcgaatgctattggtgcgtttgcggattacctcacggataagcca
ggtaatgagtccgtgcgcttgattggtgtggagccagcaggtgagggtcttgattccggt
aagcatggtgcgccgctgcagcgtggcaaggttggtgtgcaacacggcttcaagtcgttc
atcttggctgatgagcagggcaatccgctgcattcttattccgtatcggctggtcttgat
tatccgggcgtgggtccagaacacgcccacctcatggaatctggtcgtgcacaatattat
ggaattaccgatgccgaggcgcttcaggcattccgaatgctgagccgctacgagggtatc
attccagctttggagtctagccacgctctagcatatgcgttaaagatggcagaaaacacc
gaagaaaccgatactcccattaacattgtggtcaatctttcgggtcgtggcgataaggat
gtagactatgttcgcaatatcttaggcgacctcgctaccgaggatccagcaacttcacca
gtcacggaccctcatgtcgccgaaaccctcgccgcaatgatcgctgagtccaatgcacga
gagggagtctaa

DBGET integrated database retrieval system