KEGG   Corynebacterium diphtheriae HC04: CDHC04_2254Help
Entry
CDHC04_2254       CDS       T01696                                 

Gene name
trpC1
Definition
indole-3-glycerol phosphate synthase
Orthology
K13498  
indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
cda  Corynebacterium diphtheriae HC04
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cda01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:cda00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2456974..2458431
Genome map
AA seq 485 aa AA seqDB search
MQNDSSTRPMPTVLESIVSGRRSHLPEIQARISHVDPARLPRSTRSLFHALGGHSDGGPA
LRGSTRFIMECKSSSPSLGMIREDYHPGDIARVYSRYAAGISVLCEPDRFGGDYNHLATV
AATTHLPVLCKDFIIHPAQVHAARYFGADAILLMLSVLDDATYTELSQEAARLGLDVLTE
VIDEVEVERAIRLGATIFGINHRNLHDLSIDLNRSARLAQLIPDSAVIVSESGIRNNETV
RQLSGHSSAFLVGSQLTSQPDVDRAARELVYGLNKVCGLQSPSEAQAARASGAIYGGLIF
VESSPRNVSRETSKKIMAAEPDLTYVAVSRRTTGWTEIIGGNIAVAQIHSPYQGSIAAEK
ELINHVRGEVGDKVKIWRAVSMTHADGPLVAEALAPEVDSLVLDTGNGGTGTTFDWARIP
EAVKGKTLLAGGIGPDNVTEALAVGCAGLDLNSGLEYPVEAGKWAAHKDATAIHSTFTQI
RGFHY
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgcagaatgattcgtcgacacgccccatgcccaccgtcctagaatccatcgtttcgggc
cgacgatcccacctgcccgaaatccaagcgcggatttcccacgtggatccagcgcgacta
ccgcgttccacccgctccttgttccacgccttgggaggccatagcgatgggggtccggcg
ttgcgggggagtacgcgcttcatcatggagtgcaagtcctcctcgccgtcgcttggcatg
atccgcgaggactaccaccctggcgacatcgcgcgggtgtattcacgttatgcggccggc
atttcggtgttgtgcgagccggatcgttttggcggcgactataaccatctggccacggtg
gcggccacgacacatctgccggtgctgtgcaaggattttattatccaccccgcacaggtt
cacgcggcacgttattttggggcggacgcaattttgctcatgttgagtgtgcttgacgac
gccacctacaccgagctcagccaggaagcagcacgcttggggttggatgttctcaccgag
gttatcgacgaggttgaggtggaacgtgccattcggttgggggccacaatctttggcatt
aatcatcgcaatctgcatgacttgagcattgatttaaatcgctcagcacgccttgcgcag
ctgattcccgatagcgccgtgattgtctccgagtctggcattcggaataacgagacggtt
cgccaactcagcgggcattccagcgcattcttggtaggctcgcagcttacttctcagcca
gatgtggaccgtgcggcccgcgagcttgtgtacggcctcaataaggtgtgcggtttgcag
tcaccaagcgaggcgcaagcagcgcgcgcatcgggcgcaatctatggcggattaatcttc
gtggagtctagtccgcgtaatgtttcacgtgaaacatcgaaaaaaatcatggctgccgaa
cctgacctcacctatgtcgccgtctcacgacgcaccaccggatggaccgaaattataggt
ggcaacatcgccgttgctcagatccacagtccttaccagggctccatcgccgccgaaaaa
gaactcattaaccatgtgcgcggcgaggtaggagacaaggtaaaaatctggcgtgcagtc
tccatgacgcatgccgacggcccccttgtcgccgaagcactcgcaccggaggtagacagc
ctcgtcctcgacaccggcaacggcggaaccggcaccaccttcgattgggcacgcatccca
gaagccgtaaagggcaagactcttctcgccggcggcattggaccagacaatgtcaccgag
gcactcgccgttggctgcgcgggactcgatctcaactccgggttggaatatccagtcgaa
gcagggaagtgggcagcacacaaagacgctactgcaatccactccactttcacccaaata
cgtggttttcattactaa

DBGET integrated database retrieval system