KEGG   Corynebacterium diphtheriae HC04: CDHC04_2257Help
Entry
CDHC04_2257       CDS       T01696                                 

Gene name
panB
Definition
3-methyl-2-oxobutanoate hydroxymethyltransferase
Orthology
K00606  
3-methyl-2-oxobutanoate hydroxymethyltransferase [EC:2.1.2.11]
Organism
cda  Corynebacterium diphtheriae HC04
Pathway
Pantothenate and CoA biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cda00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    CDHC04_2257 (panB)
Enzymes [BR:cda01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.11  3-methyl-2-oxobutanoate hydroxymethyltransferase
     CDHC04_2257 (panB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2459723..2460514)
Genome map
AA seq 263 aa AA seqDB search
MTRPVRLQDLRDYKKNNRPWAMLTTYDYSTTRAFVDAGIEVFLVGDSAANTMLGYSGTNQ
VSFEEMVMLTAAVVRGAGPAMVVADLPFGTYEASDEQAVRSATEMVRRTGAHVVKLEGGV
RMASRIRAITDAGVPVCAHLGFTPQSMNQLSGFKVQRGAEKLTADVDAVVEAGAEMVVFE
MVPADLAAELTARCPIPVIGIGAGNATDAQVLVWHDIANLPKGDHRARFVKTYAEVGSQL
TCAARFYRKDVEARRFPAEEHTF
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
gtgacccgtcccgtccgactgcaagacttgcgcgactacaaaaagaacaaccgtccgtgg
gccatgctgaccacctacgactactccaccactcgcgcatttgtggacgcgggtatcgag
gttttcctcgtaggagattctgcagccaacacaatgctgggatattccggaactaaccag
gtgagctttgaggagatggtcatgctcacggcggcggtggtgcgcggtgcgggtcctgcg
atggtggtggctgaccttccgttcggcacctacgaggcgagtgacgagcaggcggtgcgc
agtgccacggagatggttcgtcgaactggtgctcacgtggtcaagcttgaaggtggcgtt
cggatggcgtcgcggattcgcgctattacagatgcaggggttccggtgtgcgcacaccta
ggttttactccgcagtcgatgaatcagctttctggttttaaggtgcagcgaggcgcggag
aagctgacggctgatgtggatgctgtcgtggaggcgggtgcagagatggtggtgtttgag
atggttccggcggatcttgcggcggagcttactgcccgctgcccgattccggtgattgga
attggcgccggcaatgctaccgacgcccaggtgttggtgtggcacgatatcgcgaatctt
cctaaaggtgatcatcgtgcccgttttgttaagacgtatgcggaggttggttcgcagctt
acttgcgcggcgcggttctatcggaaggatgtagaggcacgccgcttccccgctgaggag
cacacgttctaa

DBGET integrated database retrieval system