KEGG   Corynebacterium diphtheriae HC04: CDHC04_2259Help
Entry
CDHC04_2259       CDS       T01696                                 

Gene name
trpA
Definition
(RefSeq) tryptophan synthase subunit alpha
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cda  Corynebacterium diphtheriae HC04
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cda00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CDHC04_2259 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CDHC04_2259 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CDHC04_2259 (trpA)
Enzymes [BR:cda01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CDHC04_2259 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
2462084..2462920
Genome map
AA seq 278 aa AA seqDB search
MTRYTKLFSALSAKNEGAFVPFIMLGDPTPEASLAIIRTVVAAGADALELGVPFSDPVAD
GPTIQRSHLRALDNGTTVDSSLELIRQIRKEFPELPIGMLIYGNVAFTRGITQFYQEFAD
AGVDSILLPDVPVREGEPFIAAAKQPGIDPIFIAPAQASEATLEEVAQHSSGYIYAISRD
GVTGAERQSSTRGLDQVVANAKRFGGAPILLGFGISTPEHVRDAIAAGASGAITGSALTS
IIERHTTGTHPEPAQVTDLEALTEEIFTFVKDMKAATR
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgactcgctacaccaaattattctccgcactcagcgccaaaaacgaaggtgcattcgtc
cccttcatcatgctgggcgatcccaccccagaggcgtcgttagcaatcatccgtaccgtc
gttgccgcgggtgccgacgccctcgaactcggcgtccccttctccgacccggtagcagac
ggccccacaatccaacgctcccacctccgtgccctcgacaacggaaccaccgtcgatagc
tcgctggaactgatccgacagatccgcaaagaattccccgaacttcccatcggcatgctc
atctacggcaacgttgccttcacccgcgggatcacccagttctatcaagaattcgccgac
gccggcgtagactccatcctgcttcccgacgtccctgtccgcgaaggcgagcctttcatc
gcagctgccaagcaacctgggatcgaccccatcttcatcgcccccgcacaagcctcggaa
gcaaccttggaagaggtagcgcaacactccagcggatacatctacgccatctcccgcgat
ggtgtgaccggagccgaacgccaatcctctactaggggactagaccaagtggtggcaaat
gcgaaacgcttcggcggagcaccgatcctgctcggtttcggtatctccactcccgagcat
gtgcgcgacgccatcgcggcaggagccagcggcgccattacaggctccgcgctgacgtcg
atcatcgagcggcacaccacaggcacacacccagagccagcccaagtgacagaccttgag
gctctcaccgaagaaattttcacgttcgttaaagacatgaaagccgcaacccgttaa

DBGET integrated database retrieval system