KEGG   Corynebacterium diphtheriae BH8: CDBH8_0613Help
Entry
CDBH8_0613        CDS       T01698                                 

Gene name
rbsK
Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
cdb  Corynebacterium diphtheriae BH8
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:cdb00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CDBH8_0613 (rbsK)
Enzymes [BR:cdb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     CDBH8_0613 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(610099..611004)
Genome map
AA seq 301 aa AA seqDB search
MSSSMTVVGSINADVSIQVARHPSPGETVLGHDSTISPGGKGANQAVAAALQGASVSFVG
AVGNDTYADHALKILRSAGVNLDAVETIDDNTGVAYIQVSDDGENSIIVIPGANAHVTAD
YVEHHRKPIEDADIVLLQGEIPADGFSAAVQAARGTVVVNLAPVIDVDRDCLLRADPLMA
NEHEAALILEQLGAPVTSEDPRVLIEALRSQGFASVVLTLGGHGALIADASGVTPIATPY
VTAVDTTGAGDAFAGAFVARRLQGDSLIDAATFAARVGAFSVQGRGAQTSYPSESDTLPA
V
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcatctatgactgttgttggttcgatcaacgctgacgtcagcatccaagtagca
cgacatcccagcccaggtgaaaccgtcctaggccacgactccaccatcagccccggcggc
aaaggcgcaaaccaagccgttgccgctgcgctccaaggcgcatcagtatctttcgtaggc
gcagtaggaaacgacacttatgccgaccacgcactgaaaatcctgcgatctgccggcgtg
aacttagacgcagtcgaaacaatcgacgacaacaccggcgttgcgtacattcaagtctcc
gacgatggcgaaaacagcatcatcgttattcccggcgcgaacgcgcatgtcaccgcggac
tacgtagagcaccatcgtaaacctattgaggacgccgacatcgtgctcttacagggtgag
attcccgcggatggttttagcgccgcagtgcaagcagctcgaggcaccgtggtagtcaat
cttgcgcctgtgattgatgtcgatcgtgactgtctcctacgcgcggatccgttgatggct
aatgagcatgaggcggcgttgattctagagcaactcggcgctccggtaaccagtgaagat
ccccgcgttctgatcgaggcactgcgttcgcaagggtttgcctccgtggtgttgaccctt
ggtggacatggcgcgctgatcgccgatgcttctggtgtaacaccgattgccaccccatac
gtcacagcagtagacaccacgggtgctggtgacgcattcgcaggggctttcgtggcacgt
cgtttgcaaggagactcgcttatcgacgccgccacgttcgcagcccgtgtcggagcgttc
tccgtccagggtcgtggggcgcaaacttcttatccttctgagtccgatacgctgcccgcg
gtgtag

DBGET integrated database retrieval system