KEGG   Corynebacterium diphtheriae BH8: CDBH8_0769Help
Entry
CDBH8_0769        CDS       T01698                                 

Gene name
echA2
Definition
(RefSeq) enoyl-CoA hydratase (EC:4.2.1.17)
  KO
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
cdb  Corynebacterium diphtheriae BH8
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:cdb00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    CDBH8_0769 (echA2)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    CDBH8_0769 (echA2)
   00650 Butanoate metabolism
    CDBH8_0769 (echA2)
  Lipid metabolism
   00071 Fatty acid degradation
    CDBH8_0769 (echA2)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CDBH8_0769 (echA2)
   00310 Lysine degradation
    CDBH8_0769 (echA2)
   00360 Phenylalanine metabolism
    CDBH8_0769 (echA2)
   00380 Tryptophan metabolism
    CDBH8_0769 (echA2)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CDBH8_0769 (echA2)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CDBH8_0769 (echA2)
   00281 Geraniol degradation
    CDBH8_0769 (echA2)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CDBH8_0769 (echA2)
   00627 Aminobenzoate degradation
    CDBH8_0769 (echA2)
   00930 Caprolactam degradation
    CDBH8_0769 (echA2)
Enzymes [BR:cdb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CDBH8_0769 (echA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
765892..766668
Genome map
AA seq 258 aa AA seqDB search
MAQVEVRIDGHLICVTVNRHEARNALSAQMCDDITSALNNADEQARDTAAIRAVLIRSVG
TTFCAGADLGSTTQSDDAAEVTQSDFHDSLTRMLESVVSCGVPVIADIQGPAVGAGMQLA
LSCDLRLVHHAAWFKVPAASLGFALDGWTINRAQCLLGGGWARSIFLGGATLSAPQAVAT
GFALEIADSDSAIAYAHRIAGMAPLALRQLKSALNSADFEYALVGESRDLFAQCWASTDA
REGQLARKQKRDPVFTGR
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
gtggcgcaggtagaggtgcgtatcgacggccacctgatatgtgtcaccgtaaatagacac
gaggctcgcaacgcactttctgcacagatgtgcgatgatattacatctgctcttaataat
gcagatgagcaggcgcgtgacactgcagctattcgcgccgtgctcatccgttctgttggt
acgaccttttgtgccggagcggatttgggcagtaccacccaaagtgatgatgcggctgag
gtaacgcagtcggatttccatgattctcttacgcgcatgttggaatcggttgtttcctgt
ggagtcccagttattgctgatattcaaggaccagctgttggcgctggcatgcagctggca
ttgagctgcgacctgcgtttggttcatcatgctgcatggtttaaggtgccggcggcgtct
cttgggttcgcgctcgacggatggactattaatagggcacagtgtttgctgggcggcggt
tgggcgcgatcaattttcctgggcggcgcaacgctatcggcaccgcaggcggtggcaact
ggttttgcgctggagatcgctgattccgattctgcgattgcctatgctcatcgtattgct
ggaatggcccccttggcgctgcggcaacttaaatccgcgctcaacagtgctgattttgaa
tatgcgcttgttggggaatctcgtgatctttttgcccaatgttgggctagtacggatgct
cgcgaagggcagctggctcgaaaacaaaagcgagatccggtatttactggtcgctga

DBGET integrated database retrieval system