KEGG   Corynebacterium diphtheriae BH8: CDBH8_0769Help
Entry
CDBH8_0769        CDS       T01698                                 

Gene name
echA2
Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
cdb  Corynebacterium diphtheriae BH8
Pathway
cdb00071  Fatty acid degradation
cdb00280  Valine, leucine and isoleucine degradation
cdb00310  Lysine degradation
cdb00360  Phenylalanine metabolism
cdb00362  Benzoate degradation
cdb00380  Tryptophan metabolism
cdb00410  beta-Alanine metabolism
cdb00627  Aminobenzoate degradation
cdb00640  Propanoate metabolism
cdb00650  Butanoate metabolism
cdb00903  Limonene and pinene degradation
cdb01100  Metabolic pathways
cdb01110  Biosynthesis of secondary metabolites
cdb01120  Microbial metabolism in diverse environments
cdb01130  Biosynthesis of antibiotics
cdb01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:cdb00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    CDBH8_0769 (echA2)
   00650 Butanoate metabolism
    CDBH8_0769 (echA2)
  Lipid metabolism
   00071 Fatty acid degradation
    CDBH8_0769 (echA2)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CDBH8_0769 (echA2)
   00310 Lysine degradation
    CDBH8_0769 (echA2)
   00360 Phenylalanine metabolism
    CDBH8_0769 (echA2)
   00380 Tryptophan metabolism
    CDBH8_0769 (echA2)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CDBH8_0769 (echA2)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CDBH8_0769 (echA2)
   00281 Geraniol degradation
    CDBH8_0769 (echA2)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CDBH8_0769 (echA2)
   00627 Aminobenzoate degradation
    CDBH8_0769 (echA2)
   00930 Caprolactam degradation
    CDBH8_0769 (echA2)
Enzymes [BR:cdb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CDBH8_0769 (echA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AEX48294
Position
765892..766668
Genome map
AA seq 258 aa AA seqDB search
MAQVEVRIDGHLICVTVNRHEARNALSAQMCDDITSALNNADEQARDTAAIRAVLIRSVG
TTFCAGADLGSTTQSDDAAEVTQSDFHDSLTRMLESVVSCGVPVIADIQGPAVGAGMQLA
LSCDLRLVHHAAWFKVPAASLGFALDGWTINRAQCLLGGGWARSIFLGGATLSAPQAVAT
GFALEIADSDSAIAYAHRIAGMAPLALRQLKSALNSADFEYALVGESRDLFAQCWASTDA
REGQLARKQKRDPVFTGR
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
gtggcgcaggtagaggtgcgtatcgacggccacctgatatgtgtcaccgtaaatagacac
gaggctcgcaacgcactttctgcacagatgtgcgatgatattacatctgctcttaataat
gcagatgagcaggcgcgtgacactgcagctattcgcgccgtgctcatccgttctgttggt
acgaccttttgtgccggagcggatttgggcagtaccacccaaagtgatgatgcggctgag
gtaacgcagtcggatttccatgattctcttacgcgcatgttggaatcggttgtttcctgt
ggagtcccagttattgctgatattcaaggaccagctgttggcgctggcatgcagctggca
ttgagctgcgacctgcgtttggttcatcatgctgcatggtttaaggtgccggcggcgtct
cttgggttcgcgctcgacggatggactattaatagggcacagtgtttgctgggcggcggt
tgggcgcgatcaattttcctgggcggcgcaacgctatcggcaccgcaggcggtggcaact
ggttttgcgctggagatcgctgattccgattctgcgattgcctatgctcatcgtattgct
ggaatggcccccttggcgctgcggcaacttaaatccgcgctcaacagtgctgattttgaa
tatgcgcttgttggggaatctcgtgatctttttgcccaatgttgggctagtacggatgct
cgcgaagggcagctggctcgaaaacaaaagcgagatccggtatttactggtcgctga

DBGET integrated database retrieval system