KEGG   Corynebacterium diphtheriae BH8: CDBH8_1542Help
Entry
CDBH8_1542        CDS       T01698                                 

Gene name
trpC2
Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
cdb  Corynebacterium diphtheriae BH8
Pathway
cdb00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cdb01100  Metabolic pathways
cdb01110  Biosynthesis of secondary metabolites
cdb01130  Biosynthesis of antibiotics
cdb01230  Biosynthesis of amino acids
Module
cdb_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cdb00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CDBH8_1542 (trpC2)
Enzymes [BR:cdb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     CDBH8_1542 (trpC2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS FMN_dh QRPTase_C OMPdecase PDZ
Motif
Other DBs
NCBI-ProteinID: AEX49060
Position
complement(1594847..1595653)
Genome map
AA seq 268 aa AA seqDB search
MVTVFDEIIAGVVEDVAAREAQVSFQDIKAQSRLCAPPRDACGALLASGCGIIAEIKRAA
PGQGLLAEIPSPVDLALELESGGAALIACHTERRRFHGSLTEMAKIRRHVSVPVMCRDFI
VDPYQIHEARCYGADMVPLRVAALAQSRLVALIDRVESLGMAALVEVRDTAEASRALDAG
ARIIGVNARDFSTMTLNRAAFCEIAPGLPSDVVRVALSGVRNAKELLDYASAGADAVVIG
QSIVTAQSPRGATRALVAAGQHPSCPSR
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggttacagtcttcgatgagatcatcgctggtgttgtggaagacgttgccgcgcgcgaa
gcgcaggtttcattccaggacatcaaagcgcagtctcgtctgtgcgcgccacctagggat
gcttgtggggcattgttagcaagtggctgtggaatcatcgcggagatcaaaagggcagca
cctggccaaggtttgcttgcggagattccttcgccggtagatctggctcttgagctcgag
tccggcggtgcggcgttgattgcttgtcacacagagcgccggcggtttcatgggtctttg
acggagatggcgaagattcgtcgtcacgtgtccgttccagttatgtgtcgcgattttatt
gttgatccctatcagattcatgaagctcgctgctatggagctgatatggtgccgcttcgg
gtagctgcgcttgcgcagtcacgacttgttgcattgattgatcgggtggagtccctgggg
atggctgcgcttgtcgaggtacgtgatactgcggaggcatctcgtgccttagatgctggt
gctcgaattatcggtgttaatgcgagagatttttctacgatgacccttaaccgagcggct
ttttgtgagatcgctccaggacttcctagcgacgtggtccgagtggcgctttcaggggtt
cgtaatgctaaagagcttttagactacgcctcggctggggcagacgccgtggtcattggt
caaagcatcgtgacggcgcaatcgcctcgaggggcgacgcgtgccttggttgctgcaggc
cagcatccctcgtgtccctcacgttag

DBGET integrated database retrieval system