KEGG   Corynebacterium diphtheriae BH8: CDBH8_1605Help
Entry
CDBH8_1605        CDS       T01698                                 

Gene name
glk
Definition
(GenBank) glucose kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
cdb  Corynebacterium diphtheriae BH8
Pathway
cdb00010  Glycolysis / Gluconeogenesis
cdb00052  Galactose metabolism
cdb00500  Starch and sucrose metabolism
cdb00520  Amino sugar and nucleotide sugar metabolism
cdb00521  Streptomycin biosynthesis
cdb01100  Metabolic pathways
cdb01110  Biosynthesis of secondary metabolites
cdb01120  Microbial metabolism in diverse environments
cdb01130  Biosynthesis of antibiotics
cdb01200  Carbon metabolism
Module
cdb_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cdb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CDBH8_1605 (glk)
   00052 Galactose metabolism
    CDBH8_1605 (glk)
   00500 Starch and sucrose metabolism
    CDBH8_1605 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    CDBH8_1605 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CDBH8_1605 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    CDBH8_1605 (glk)
Enzymes [BR:cdb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     CDBH8_1605 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase TCR Hydant_A_N
Motif
Other DBs
NCBI-ProteinID: AEX49123
Position
complement(1662853..1663806)
Genome map
AA seq 317 aa AA seqDB search
MTNMSESVTVGFDIGGTNMRAAAVTDSGLIIDSVSVPTPKTSEALEKGIISLVAQLREKH
EVSAVGLAVAGFLDPDCEIVRFAPHLPWRDRPVRAELEDALRLPVRLEHDANSAAWGEYR
FGAARGSQNWVLFAVGTGIGATLMHEGEIYRGAFGTAPEFGHLTVVPQGRQCSCGKSGCL
ERYCSGTAIEATARELLDADRGRDSMVAAAYHSGTLSGKTVTEAARQGDVFAIEVFDDFA
EWMGRALSIVCDVLDPGQIVIGGGLSTSSDLFLEKATQHMAQQIVGAGYRPLPTVVCAEL
GGDAGMIGVSDLARRRV
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgacgaatatgtcagaatctgtcactgtcggattcgacatcggtggaaccaatatgcga
gcagcggcggtgacggattccggtttgatcatcgactcggtttcggttcctacccctaaa
acttctgaggctctggaaaaaggcattatttctctggtagctcaattgcgggaaaagcat
gaggtttcggctgtaggccttgccgttgcaggttttttggatcctgattgcgaaatcgtt
cgctttgctccgcatctgccgtggcgtgaccgcccagtgcgtgcggaattagaggacgcg
ttgagacttcctgttcgtcttgaacatgatgcgaattctgcagcgtggggagaataccgc
ttcggagcggcacgtggttcgcaaaactgggtcttattcgcggttggcactggtatcggt
gccacactgatgcatgagggcgagatctaccgtggtgcttttggcacagctcctgagttc
ggccaccttaccgttgtccctcaaggtcggcagtgttcttgtggcaagagtggctgtttg
gaacgttattgttccggcactgctattgaagcgactgcgcgtgagcttctcgacgccgat
cgtggccgcgactcgatggttgctgctgcctatcattcgggcacattgagtgggaaaact
gtgaccgaagcggctcgccagggtgatgtttttgccatcgaggtctttgatgattttgct
gaatggatgggccgcgccttgtctatcgtgtgtgatgttttggatccggggcagatcgtg
attggtggcgggttgtccacgtcaagcgatttgttcttggaaaaggctactcagcacatg
gcacagcagattgtcggggctgggtatcgcccccttccgacggtggtgtgtgccgaattg
ggtggcgatgccggtatgatcggggtatctgatctggctcggcgtcgcgtctag

DBGET integrated database retrieval system