KEGG   Corynebacterium diphtheriae BH8: CDBH8_1605Help
Entry
CDBH8_1605        CDS       T01698                                 

Gene name
glk
Definition
glucose kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
cdb  Corynebacterium diphtheriae BH8
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cdb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CDBH8_1605 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CDBH8_1605 (glk)
   00052 Galactose metabolism
    CDBH8_1605 (glk)
   00500 Starch and sucrose metabolism
    CDBH8_1605 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    CDBH8_1605 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CDBH8_1605 (glk)
   00524 Butirosin and neomycin biosynthesis
    CDBH8_1605 (glk)
Enzymes [BR:cdb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     CDBH8_1605 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1662853..1663806)
Genome map
AA seq 317 aa AA seqDB search
MTNMSESVTVGFDIGGTNMRAAAVTDSGLIIDSVSVPTPKTSEALEKGIISLVAQLREKH
EVSAVGLAVAGFLDPDCEIVRFAPHLPWRDRPVRAELEDALRLPVRLEHDANSAAWGEYR
FGAARGSQNWVLFAVGTGIGATLMHEGEIYRGAFGTAPEFGHLTVVPQGRQCSCGKSGCL
ERYCSGTAIEATARELLDADRGRDSMVAAAYHSGTLSGKTVTEAARQGDVFAIEVFDDFA
EWMGRALSIVCDVLDPGQIVIGGGLSTSSDLFLEKATQHMAQQIVGAGYRPLPTVVCAEL
GGDAGMIGVSDLARRRV
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgacgaatatgtcagaatctgtcactgtcggattcgacatcggtggaaccaatatgcga
gcagcggcggtgacggattccggtttgatcatcgactcggtttcggttcctacccctaaa
acttctgaggctctggaaaaaggcattatttctctggtagctcaattgcgggaaaagcat
gaggtttcggctgtaggccttgccgttgcaggttttttggatcctgattgcgaaatcgtt
cgctttgctccgcatctgccgtggcgtgaccgcccagtgcgtgcggaattagaggacgcg
ttgagacttcctgttcgtcttgaacatgatgcgaattctgcagcgtggggagaataccgc
ttcggagcggcacgtggttcgcaaaactgggtcttattcgcggttggcactggtatcggt
gccacactgatgcatgagggcgagatctaccgtggtgcttttggcacagctcctgagttc
ggccaccttaccgttgtccctcaaggtcggcagtgttcttgtggcaagagtggctgtttg
gaacgttattgttccggcactgctattgaagcgactgcgcgtgagcttctcgacgccgat
cgtggccgcgactcgatggttgctgctgcctatcattcgggcacattgagtgggaaaact
gtgaccgaagcggctcgccagggtgatgtttttgccatcgaggtctttgatgattttgct
gaatggatgggccgcgccttgtctatcgtgtgtgatgttttggatccggggcagatcgtg
attggtggcgggttgtccacgtcaagcgatttgttcttggaaaaggctactcagcacatg
gcacagcagattgtcggggctgggtatcgcccccttccgacggtggtgtgtgccgaattg
ggtggcgatgccggtatgatcggggtatctgatctggctcggcgtcgcgtctag

DBGET integrated database retrieval system