KEGG   Corynebacterium diphtheriae BH8: CDBH8_1625Help
Entry
CDBH8_1625        CDS       T01698                                 

Gene name
sucB
Definition
(GenBank) dihydrolipoamide acetyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cdb  Corynebacterium diphtheriae BH8
Pathway
cdb00020  Citrate cycle (TCA cycle)
cdb00310  Lysine degradation
cdb01100  Metabolic pathways
cdb01110  Biosynthesis of secondary metabolites
cdb01120  Microbial metabolism in diverse environments
cdb01130  Biosynthesis of antibiotics
cdb01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cdb00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CDBH8_1625 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    CDBH8_1625 (sucB)
Enzymes [BR:cdb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     CDBH8_1625 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H
Motif
Other DBs
NCBI-ProteinID: AEX49143
Position
1683740..1685353
Genome map
AA seq 537 aa AA seqDB search
MAHSVVMPELGESVTEGTITQWLKSVGDTVTADEPLLEVSTDKVDTEVPSPVSGVLLEIK
FEEDDTVDVGDVIAIIGEEGDAPAAKEEPAEEPKAEAPKAEAADSTDVVMPELGESVTEG
TITQWLKSVGDTVDVDEPLLEVSTDKVDTEVPSPVAGTILEILFNEDDTVDVGDVIVRVG
TPGSAPAAKEEPAKEPKAETPKEEPKAEAPKAEAKKEAPAKNINNENVPYVTPLVRKLAD
KHGVDLTTVEGTGIGGRIRKQDVLAAAGVGAAPAAQAAPAQPVSAASTKSVDPEKQKLIG
TTQKVNRIREITARKTVEALQISAQLTQLHEVDMTKVAELRKANKPAFQEKHGVNLTYLP
FFAKAIVEALVAHPNVNASYNAETKEMTYHADVNLSIAVDTPAGLLTPVIHKAQELSLPE
LAKAIVDLADRARNNKLKPNDLSGGTFTITNIGSEGALSDTPILVPPQAGILGTGAIVKR
PVVITEDGIDSIAIRQMVYLPLTYDHQIVDGADAGRFLTTIKDRLETANFEGDLELS
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atggcgcactccgttgtaatgcctgaactgggcgaatccgtcaccgaaggtaccatcacc
cagtggctgaagtccgttggtgacacggtcactgccgacgagccgttgctcgaggtatct
actgacaaggtcgacactgaagttccttcgcctgtctccggtgtcttgcttgagatcaag
tttgaggaagatgacaccgtagacgtcggagacgttattgcgattattggcgaagaaggc
gacgctccagcagccaaggaagagccagccgaggagccaaaagccgaggcaccaaaggct
gaagcagctgactccaccgacgtagtcatgccagaactcggcgaatccgtcaccgaaggc
accatcacccagtggctgaagtccgttggcgacaccgtcgacgttgacgaaccactcctc
gaagtctccactgacaaggtcgacaccgaagtcccatccccagtcgctggcaccatcctc
gaaattctcttcaacgaagacgacaccgtcgacgtcggagacgtaatcgttcgcgttggc
accccaggatctgctccagctgccaaggaagagccagccaaggagccaaaagccgagaca
ccaaaggaagagccaaaagctgaggcaccaaaggctgaagcaaagaaggaagctcctgcc
aagaacatcaacaacgagaacgtcccttacgtcactccactggtccgcaagctggctgac
aagcacggcgttgatctgaccactgtggaaggcactggtatcggtggacgcatccgcaag
caggatgttttggctgccgctggtgttggcgcagctcctgcagcacaggctgctcctgcc
cagccagtttctgcagcatccaccaagtccgtggatccagagaagcagaagctgatcggt
accactcaaaaggtcaaccgtatccgcgaaatcaccgctcgcaagactgtggaggctttg
cagatttctgctcagctcacccagctgcatgaggtcgatatgaccaaggttgcggaactt
cgtaaggccaacaagccagccttccaggaaaagcacggtgtgaacctcacctacttgcca
ttctttgcaaaagcaattgttgaggctttggttgcccatccgaacgtcaatgcgtcctac
aacgctgagaccaaggaaatgacctaccacgctgatgtcaacctctccattgctgttgat
accccagctggtctgctcacccctgtaatccacaaagctcaagagttgtctttgccggag
ctagctaaggcaattgtcgacttggctgaccgtgctcgtaacaacaagctcaagccgaat
gacctttccggcggtaccttcaccattaccaacattggttccgaaggtgcactcagcgat
accccaatcttggttcctccacaggcaggcatcttgggcaccggcgctattgttaagcgt
ccagtagtcatcacggaagacggcatcgattcgattgctattcgccagatggtctacttg
ccacttacctacgatcaccagatcgtcgatggtgccgatgcaggtcgtttcttgaccacc
atcaaggatcgccttgagactgccaacttcgaaggcgacctcgaactctcctag

DBGET integrated database retrieval system