KEGG   Corynebacterium diphtheriae BH8: CDBH8_1749Help
Entry
CDBH8_1749        CDS       T01698                                 

Gene name
proB
Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
cdb  Corynebacterium diphtheriae BH8
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cdb01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:cdb00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1812321..1813451)
Genome map
AA seq 376 aa AA seqDB search
MNAQHSSADLRDVIRNAKRIVVKIGSSSLTGENFEVSPGRIDRIVEALEDRMRRGSDVIV
VSSGAVAAGMAPLGLTSRPKDLATKQAAASVGQVHLANAWGNSFARYNRTIGQVLLTASD
AGQRDRARNAQRTIDRLRLLHAVPVINENDTVATSEMHFGDNDRLAAIVSHLVSADALVL
LSDVDGLYDKNPADPSARFVSEVRDGNDLKGVIAGDGGAVGTGGMASKVSAARLASRSGV
PVLLTSADYVAEALGDAEVGTVFYPKDDRLSAWKFWALYAADTGGALRIDAGAVSAVTAG
GNSLLAVGITEVIGDFHAGEIVEILGPEGEIIGRGEVAYDSAVLTTMLGKQTAQLPEGLQ
RPVVHADYLSDYASRA
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcccagcacagtagcgccgatctgcgtgacgtgattagaaacgctaagcggatt
gtggtcaagattggttctagttcactgaccggcgaaaattttgaggtttctccgggtcgt
atcgaccgcattgtggaggctctagaagatcgtatgcggcgcggttccgacgtgattgtt
gtatcttctggtgctgtggctgctggtatggctccattggggttgacttcgcggccgaag
gatttggcaacaaagcaagctgctgcctcggtggggcaggtgcatttggctaatgcgtgg
ggtaatagttttgcccgttataaccgcacgattggccaagtgctgttaacggcctccgac
gcaggccagcgggatcgtgcgcgtaatgcgcagcgcactattgatcgcttgcggttgcta
cacgcagtgccggttattaatgagaatgacacggttgcaacctctgagatgcactttgga
gacaacgaccgccttgccgcgattgtgtcgcacctagtgtccgcggacgcattggtgctg
ctctcggacgtagatgggttgtatgacaaaaaccctgcggatccttcggcacgatttgtg
tctgaagtcagagacggcaacgacctgaaaggtgtgatcgcaggcgatggtggggccgtg
gggaccggtggcatggcgtcgaaggtgtcggctgcgcggttggcgtcgcgaagcggcgtg
cccgttttgttgacctccgctgattatgtggccgaggcgctgggcgatgctgaggtgggt
acggtgttttaccccaaggatgatcgcctatcagcgtggaagttttgggcgctgtacgct
gcagatactggcggcgcattgcgtatcgacgccggcgcggtctccgcagtcaccgccggc
ggaaactccctgctggccgtgggaattaccgaggtcattggtgatttccacgctggtgag
atcgtggagatcctcggccctgagggtgagatcattggacgaggtgaggtggcctatgat
tccgcagtgctcaccaccatgctgggcaaacaaaccgcgcagctgcccgagggtctgcaa
cgtcccgtcgtccatgctgattatctttccgattacgcgtcacgcgcgtag

DBGET integrated database retrieval system