KEGG   Corynebacterium diphtheriae BH8: CDBH8_1808Help
Entry
CDBH8_1808        CDS       T01698                                 

Definition
hypothetical protein
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
cdb  Corynebacterium diphtheriae BH8
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cdb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    CDBH8_1808
Enzymes [BR:cdb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     CDBH8_1808
    3.5.1.-  
     CDBH8_1808
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1873294..1873743
Genome map
AA seq 149 aa AA seqDB search
MNALLIIDIHANSPAPEATEITHAIALHLGQHRGDYSHVIAALQGTIADELAGTTFGNQF
IKDPATQALSAFERTDATGTKLGDWLRANNIDRLDVVGLGTELGIRSSVLDALAQGFDVH
VHKKLCAAVSHDNARAAYNEMDMCGALFE
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcacttcttattatcgatatccacgccaactcccctgcccccgaggccaccgag
atcacccacgccatcgccctacatctcggccagcaccgcggcgactactcccacgtcatc
gcagctctccaaggcactatcgccgatgagctagccggtactacctttggtaatcaattc
attaaagaccccgccacccaggccttatccgcttttgagcgcacagatgccaccggcacc
aaactcggcgactggctccgtgccaacaacatagatcgcctcgacgttgtaggccttggc
accgaactcggcattcgctccagcgtgttagacgcactcgcccaaggatttgatgtgcac
gtgcacaaaaaactctgcgctgccgtatcacacgacaacgcccgcgctgcctataacgaa
atggacatgtgcggggcgttattcgaataa

DBGET integrated database retrieval system