KEGG   Corynebacterium diphtheriae BH8: CDBH8_1965Help
Entry
CDBH8_1965        CDS       T01698                                 

Definition
putative dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
cdb  Corynebacterium diphtheriae BH8
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cdb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CDBH8_1965
Enzymes [BR:cdb01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     CDBH8_1965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2049478..2050314)
Genome map
AA seq 278 aa AA seqDB search
MSVKDLIIPERTAVMGIVNVTEDSFSDGGRWLDIDAAIDHARDLVAAGADIIDVGGESTR
PGATRVDPDVERSRVIPVIRALSEEGIATSIDTMRASVAAAAANAGVKLINDVSGGLADR
AMYSVMADTQLPVCLMHWKTVRFGDAAGSADHGGDVVADVHQTLDKLVTSALNAGVKEDN
ITIDPGLGFAKTQEDNWALLRALPEFIAGPYPVLVGASRKRFLMAVRAARGLQSGPVDAD
PATAAVTAIAAQMGAWCVRVHEVAVSRDAVDVAALWNA
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgtgaaagacctcatcattcccgagcgaacagccgtcatgggcattgtgaacgtc
accgaagattcattttccgacggtggccgctggctcgacattgatgccgcaatcgaccac
gcccgcgacctcgtcgcagcaggcgcagacatcatcgacgtcggcggcgaatccacccgc
ccaggtgccacccgcgtcgaccccgacgtggaacgcagccgcgtgatccccgtcatccgg
gcgctatccgaagaaggcatcgccacctccatcgacaccatgcgcgccagcgttgccgcc
gcagcagccaacgccggcgtaaaactcatcaacgatgtttccggtgggctcgccgaccgc
gccatgtactccgtcatggccgacacccaactaccggtctgcctcatgcactggaagacc
gttcgcttcggggacgcagcaggaagcgccgaccacggcggcgacgttgtagcagacgta
caccagaccctagataagctggtcacctctgcactcaacgccggcgtcaaagaagacaac
atcaccatcgacccaggtctcggctttgccaaaacacaagaagataactgggcactctta
cgcgccctaccggaatttatcgcaggcccataccccgtgctcgtaggagcatcacgcaaa
cgcttcctgatggcagtccgcgccgcccgaggcctgcaatcagggccagtcgacgccgac
cccgccaccgcagcggtgacagcaatcgccgcacaaatgggagcatggtgcgtgcgcgtc
cacgaagtagcagtttcccgagacgcggtcgacgttgcggccctatggaatgcgtga

DBGET integrated database retrieval system