KEGG   Corynebacterium diphtheriae BH8: CDBH8_2293Help
Entry
CDBH8_2293        CDS       T01698                                 

Gene name
sulI
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
cdb  Corynebacterium diphtheriae BH8
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cdb00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2390914..2391765
Genome map
AA seq 283 aa AA seqDB search
MLRSRVTVFGILNLTEDSFFDESRRLDPAGAVTAAIEMLRVGSDVVDVGPAASHPDARPV
SPADEIRRIAPLLDALSDQMHRVSIDSFQPETQRYALKRGVGYLNDIQGFPDPALYPDIA
EADCRLVVMHSAQRDGIATRTGHLRPEDALDEIVRFFEARVSALRRSGVAADRLILDPGM
GFFLSPAPETSLHVLSNLQKLKSALGLPLLVSVSRKSFLGATVGLPVKDLGPASLAAELH
AIGNGADYVRTHAPGDLRSAITFSETLAKFRSRDARDRGLDHA
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgttacgcagcagggtgacggtgttcggcattctgaatctcaccgaggactccttcttc
gatgagagccggcggctagaccccgccggcgctgtcaccgcggcgatcgaaatgctgcga
gtcggatcagacgtcgtggatgtcggaccggccgccagccatccggacgcgaggcctgta
tcgccggccgatgagatcagacgtattgcgccgctcttagacgccctgtccgatcagatg
caccgtgtttcaatcgacagcttccaaccggaaacccagcgctatgcgctcaagcgcggc
gtgggctacctgaacgatatccaaggatttcctgaccctgcgctctatcccgatattgct
gaggcggactgcaggctggtggttatgcactcagcgcagcgggatggcatcgccacccgc
accggtcaccttcgacccgaagacgcgctcgacgagattgtgcggttcttcgaggcgcgg
gtttccgccttgcgacggagcggggtcgctgccgaccggctcatcctcgatccggggatg
ggatttttcttgagccccgcaccggaaacatcgctgcacgtgctgtcgaaccttcaaaag
ctgaagtcggcgttggggcttccgctattggtctcggtgtcgcggaaatccttcttgggc
gccaccgttggccttcctgtaaaggatctgggtccagcgagccttgcggcggaacttcac
gcgatcggcaatggcgctgactacgtccgcacccacgcgcctggagatctgcgaagcgca
atcaccttctcggaaaccctcgcgaaatttcgcagtcgcgacgccagagaccgagggtta
gatcatgcctag

DBGET integrated database retrieval system