KEGG   Corynebacterium diphtheriae BH8: CDBH8_2346Help
Entry
CDBH8_2346        CDS       T01698                                 

Gene name
trpB1
Definition
(GenBank) tryptophan synthase subunit beta (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cdb  Corynebacterium diphtheriae BH8
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cdb00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CDBH8_2346 (trpB1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CDBH8_2346 (trpB1)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CDBH8_2346 (trpB1)
Enzymes [BR:cdb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CDBH8_2346 (trpB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
2453582..2454913
Genome map
AA seq 443 aa AA seqDB search
MTDSTLRKTLISAYFGNYGGQFVPDALLPVLDELEQAYVDALNDPEFSRELARLQKHYLG
RPTPITECANLPLAGKGKGKARIFLKREDLVHGGAHKGNQVLAQALIARRLGKTRLIAET
GAGQHGTATAMVAALMGMDCTIYMGAKDVARQQPNVYRMRLMGATVVPVTNEHGDSMSDA
IDVALMDWVENLDTTHYLIGSAVGPHPFPTLVKEFQAVISRESREQMLELTGKLPDAVIA
AVGGGSNAIGAFADYLTDKPGNESVRLIGVEPAGEGLDSGKHGAPLQRGKVGVQHGFKSF
ILADEQGNPLHSYSVSAGLDYPGVGPEHAHLMESGRAQYYGITDAEALQAFRMLSRYEGI
IPALESSHALAYALKMAENAEETDTPINIVVNLSGRGDKDVDYVRNILGDLATEDPATSP
VTDPHVAETLATMIAESNAREGV
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgactgactccaccctccgtaagacgttaatcagcgcctactttggtaactacggcgga
cagtttgttcccgatgcgctcctgccggttctcgacgaactagagcaggcctatgtggat
gcactcaacgacccagagttttcgcgggaacttgccaggctacaaaagcactaccttggt
cgtcccactcctattaccgaatgcgccaatcttcccctagcgggtaaggggaagggtaag
gcgcggatcttcctcaaacgcgaggatctagttcacggtggcgcgcataagggcaatcag
gtgcttgcccaggcgttgattgctcgcagattgggtaaaactcgtttgatcgcagaaacc
ggtgctggtcagcacggtaccgccactgcgatggtggcggctttgatgggaatggactgc
accatttatatgggtgctaaagatgtggcccgccagcagcccaatgtgtatcgcatgcgg
ctcatgggggctacggtggtgccagtaaccaacgagcatggtgattccatgtcggatgct
atcgacgtagcgcttatggactgggtggaaaacctagataccacgcactacctgattggt
tctgcggtcggtccacatccgttccctacgctggtcaaggagtttcaggcggttatttcg
cgggaatctcgcgaacagatgctggagctaacaggcaagcttccggacgcagtgattgct
gccgtaggcggtggttcgaatgctattggtgcgtttgctgattacctcacggataagcca
ggtaatgagtccgtgcgtttgattggtgtggagccagcaggtgagggtcttgattccggt
aagcatggtgcgccgctgcagcgtggcaaggttggtgtgcaacacggcttcaagtcgttc
atcttggctgatgagcagggcaatccgctgcattcttattccgtatcggctggtcttgat
tatccgggcgtgggtccagaacacgcccacctcatggaatctggtcgtgcacaatattat
ggaattaccgatgccgaggcgcttcaggcattccgaatgctaagccgctacgagggtatc
attccagctttggagtctagccatgcgttggcctatgccctaaagatggcggaaaacgct
gaggaaaccgatactcccattaacattgtggtcaatctttcaggtcgtggcgataaagat
gtggactatgttcgcaatatcttgggcgacctcgctaccgaggatccagcaacctcacca
gtcacggatcctcatgtcgccgaaaccctcgccacaatgatcgctgagtccaatgcacga
gagggggtctaa

DBGET integrated database retrieval system